BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0667.Seq (439 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC005764-1|AAC62428.1| 420|Homo sapiens R31343_1 protein. 31 2.3 BC017592-1|AAH17592.2| 429|Homo sapiens zinc and ring finger 4 ... 29 7.0 Y12476-1|CAA73080.1| 613|Homo sapiens G protein coupled recepto... 29 9.3 BC040007-1|AAH40007.1| 613|Homo sapiens G protein-coupled recep... 29 9.3 AF502281-1|AAM18625.2| 613|Homo sapiens Parkin-associated endot... 29 9.3 AF017262-1|AAB70008.1| 613|Homo sapiens putative G protein-coup... 29 9.3 AC004925-2|AAD08853.1| 613|Homo sapiens unknown protein. 29 9.3 >AC005764-1|AAC62428.1| 420|Homo sapiens R31343_1 protein. Length = 420 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 315 RRLVKSHCLEPPDSRGSTVSNPCRIRLGWLRPXR 214 RR K+ CL PP ST + R+ +GW RP R Sbjct: 37 RRCPKASCLPPPVGPSSTQTAK-RVTMGWPRPGR 69 >BC017592-1|AAH17592.2| 429|Homo sapiens zinc and ring finger 4 protein. Length = 429 Score = 29.1 bits (62), Expect = 7.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 315 RRLVKSHCLEPPDSRGSTVSNPCRIRLGWLRP 220 RR K+ CL PP ST + R+ +GW RP Sbjct: 46 RRCPKASCLPPPVGPSSTQTAK-RVTMGWPRP 76 >Y12476-1|CAA73080.1| 613|Homo sapiens G protein coupled receptor 37 protein. Length = 613 Score = 28.7 bits (61), Expect = 9.3 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 149 GSCTRPSGRWCEATIRGIMPERL*GRSQPSRIRQGLLTVEPRESG 283 G TRP G W RG P GR P+ ++ L E E G Sbjct: 111 GPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKG 155 >BC040007-1|AAH40007.1| 613|Homo sapiens G protein-coupled receptor 37 (endothelin receptor type B-like) protein. Length = 613 Score = 28.7 bits (61), Expect = 9.3 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 149 GSCTRPSGRWCEATIRGIMPERL*GRSQPSRIRQGLLTVEPRESG 283 G TRP G W RG P GR P+ ++ L E E G Sbjct: 111 GPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKG 155 >AF502281-1|AAM18625.2| 613|Homo sapiens Parkin-associated endothelin receptor-like receptor protein. Length = 613 Score = 28.7 bits (61), Expect = 9.3 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 149 GSCTRPSGRWCEATIRGIMPERL*GRSQPSRIRQGLLTVEPRESG 283 G TRP G W RG P GR P+ ++ L E E G Sbjct: 111 GPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKG 155 >AF017262-1|AAB70008.1| 613|Homo sapiens putative G protein-coupled receptor protein. Length = 613 Score = 28.7 bits (61), Expect = 9.3 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 149 GSCTRPSGRWCEATIRGIMPERL*GRSQPSRIRQGLLTVEPRESG 283 G TRP G W RG P GR P+ ++ L E E G Sbjct: 111 GPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKG 155 >AC004925-2|AAD08853.1| 613|Homo sapiens unknown protein. Length = 613 Score = 28.7 bits (61), Expect = 9.3 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 149 GSCTRPSGRWCEATIRGIMPERL*GRSQPSRIRQGLLTVEPRESG 283 G TRP G W RG P GR P+ ++ L E E G Sbjct: 111 GPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKG 155 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,017,734 Number of Sequences: 237096 Number of extensions: 1140101 Number of successful extensions: 2402 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2400 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3545165828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -