BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0667.Seq (439 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.9 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 2.6 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 4.5 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 4.5 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 4.5 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 4.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 4.5 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 4.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 5.9 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 5.9 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 5.9 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 7.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 261 VSNPCRIRLGWLRPXRRSGIIPR 193 VS+P + + WL P +GII + Sbjct: 1224 VSSPQALFISWLPPLEPNGIITK 1246 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 261 VSNPCRIRLGWLRPXRRSGIIPR 193 VS+P + + WL P +GII + Sbjct: 1220 VSSPQALFISWLPPLEPNGIITK 1242 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 2.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 182 RTTGRSAECMNQMSETAVPLVLSS 111 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 156 ALGRAAGGAKLPSAGLCLNAXKAEASL 236 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 156 ALGRAAGGAKLPSAGLCLNAXKAEASL 236 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 156 ALGRAAGGAKLPSAGLCLNAXKAEASL 236 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 156 ALGRAAGGAKLPSAGLCLNAXKAEASL 236 ALGR AGG S+ L L+ +SL Sbjct: 5 ALGRCAGGGGRLSSVLSLSLTSLASSL 31 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 309 LVKSHCLEPPDSRGSTVSNPCRIRLGWLRP 220 ++ +C+ P ST+ +P R +L +P Sbjct: 790 MIPVYCVPVPQVNDSTILSPVREKLSSSQP 819 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 296 CDFTSRRFAFKTRDATSKPIWIRG 367 C+F +RR+ K T K + RG Sbjct: 38 CEFCNRRYRTKNSLTTHKSLQHRG 61 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 5.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 41 FCFECCPS 64 FC +CCPS Sbjct: 352 FCPDCCPS 359 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 5.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 41 FCFECCPS 64 FC +CCPS Sbjct: 352 FCPDCCPS 359 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 5.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 41 FCFECCPS 64 FC +CCPS Sbjct: 352 FCPDCCPS 359 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 20.6 bits (41), Expect = 7.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 207 GIIPRMVASHHRPLGRVHEPNVR 139 G I ++AS HR L NVR Sbjct: 219 GRISCVIASRHRNLEATESENVR 241 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 135 SFGHLVHALGRAAGGAKLPSAG 200 S LV A+ AGG PSAG Sbjct: 393 SMSALVSAVRSPAGGQLPPSAG 414 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,642 Number of Sequences: 438 Number of extensions: 1861 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -