BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0662.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb... 26 2.7 SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosa... 26 3.6 SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos... 25 8.4 >SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pombe|chr 3|||Manual Length = 1647 Score = 26.2 bits (55), Expect = 2.7 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +1 Query: 106 NRQLSLLINENIQ*HSIYICAVRHFYISVPTDLVVTILYDSEYDNITIG 252 +R LS + +N+Q +++++ RH IS+ L +Y +D + G Sbjct: 800 SRILSSKVRDNLQNNNLHVYLTRHPAISLLEALYTESVYSGLFDLVEYG 848 >SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 25.8 bits (54), Expect = 3.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 473 VGXLSGSNLREFANTSHSKSSASQIXRPDPN 381 V +SG N E ANT H S S P P+ Sbjct: 369 VAFMSGLNNMELANTDHEWSVGSSSPEPLPS 399 >SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 24.6 bits (51), Expect = 8.4 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -3 Query: 476 RVGXLSGSNLREFANTSHSKSSASQIX----RPDPNRGSIYSLXLHLYGSCTS 330 ++ SG LRE S SK+S I P+ N +YSL Y SC S Sbjct: 166 KLNWASGGGLRE---KSISKASEYSIFVGDLSPNVNEFDVYSLFASRYNSCKS 215 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,732,769 Number of Sequences: 5004 Number of extensions: 30565 Number of successful extensions: 51 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -