BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0661.Seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46809| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 28 5.7 SB_40156| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_46809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 549 VHLHSDPKLDRAQRFINF 602 +HLH P L+RA F+NF Sbjct: 5 IHLHQKPDLERALNFLNF 22 >SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) Length = 1486 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = +3 Query: 243 LIKSQTVSRRIR*TRFIPYKVHLSVGNWHALVNIYTEDIFRHYDRKYIDNQWREVKVKR 419 L+K S R+ +P ++G W L + D+F+ Y++ Y+ RE ++++ Sbjct: 779 LLKVDNCSVRVGNIDIMPISEVRNLGAWRNLQDTNRYDVFKTYEKLYLSKVEREDRLEQ 837 >SB_40156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 288 FIPYKVHLSVGNWHALVNIYTEDIFRHYDRKYIDNQWREVK 410 FI K+ + +G+W L N+Y ++ Y D W +++ Sbjct: 195 FIAIKI-IQIGDWAKLQNVYRDEDGAKLQNVYRDEDWAKLQ 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,498,604 Number of Sequences: 59808 Number of extensions: 287734 Number of successful extensions: 490 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -