BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0658.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0165 - 14758453-14758752,14759991-14760770 28 3.6 12_02_0185 + 15050613-15051320,15055443-15055742 28 4.8 >12_02_0165 - 14758453-14758752,14759991-14760770 Length = 359 Score = 28.3 bits (60), Expect = 3.6 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -1 Query: 376 YKHSNQRSLFHHGDSDVYYARVIKSLLIEEKGLIMN 269 ++H++ RSL+ D D +++V ++ + L+M+ Sbjct: 148 FEHTHGRSLWEVADGDAAFSKVFNDAMVSDSRLVMD 183 >12_02_0185 + 15050613-15051320,15055443-15055742 Length = 335 Score = 27.9 bits (59), Expect = 4.8 Identities = 8/36 (22%), Positives = 23/36 (63%) Frame = -1 Query: 376 YKHSNQRSLFHHGDSDVYYARVIKSLLIEEKGLIMN 269 ++H++ RS++ D D + +V+ + ++ + L+M+ Sbjct: 122 FEHTHGRSMWEMADDDAAFNKVVNNRMVSDSRLVMD 157 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,347,893 Number of Sequences: 37544 Number of extensions: 171438 Number of successful extensions: 253 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -