BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0658.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_45852| Best HMM Match : I-set (HMM E-Value=0) 27 6.5 SB_34021| Best HMM Match : Zip (HMM E-Value=0) 27 6.5 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_46445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 27.5 bits (58), Expect = 6.5 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = -1 Query: 124 CLSKIKENLTIVIKIQTIF 68 C+SKI+++ I+IKI+++F Sbjct: 43 CISKIRQSAEIIIKIRSVF 61 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = -1 Query: 415 FNILTLFRLEHGHYKHSNQRSLFHHGDSDVYYARVIKSLLIEEKG 281 FN R H HY H Q HH Y L+I+ G Sbjct: 1029 FNHYHHHRRRHHHYHHQQQHQFHHHHHHTHYNYHYRHFLIIDRPG 1073 >SB_34021| Best HMM Match : Zip (HMM E-Value=0) Length = 808 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 385 HGH-YKHSNQRSLFHHGDSDVY 323 HGH ++H ++ L+HH D D Y Sbjct: 366 HGHSHEHEPKQDLYHHEDFDSY 387 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 391 LEHGHYKHSNQRSLFHHGDSDVYYARVIKSLLIE 290 L H HY +QR HH + Y+ ++I ++ +E Sbjct: 17 LHHHHYHRQSQRHHQHHNNHYHYHIKLIDTVDLE 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,640,007 Number of Sequences: 59808 Number of extensions: 212604 Number of successful extensions: 440 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -