BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0656.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 2.1 03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622... 29 2.8 10_08_0900 - 21436508-21437521 29 3.7 04_03_0150 + 11877714-11878487,11880928-11881245 28 4.9 01_05_0005 - 16886553-16886946,16887079-16887404 28 6.5 03_06_0180 + 32175658-32178145,32178765-32178808 27 8.6 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -3 Query: 560 EKRLPTSXEGSRRAN--YPPRHGEVVTKNNDTGLL 462 EK LP S EGS ++ YPP HG+V +G+L Sbjct: 285 EKFLPLSSEGSTGSHCWYPPGHGDVFFSLCKSGIL 319 >03_05_1065 + 30061588-30061883,30061995-30062056,30062196-30062276, 30062391-30062464,30062547-30062629,30063044-30063147, 30063526-30063665,30063736-30063783,30063939-30063991, 30064178-30064262,30064346-30064412,30064496-30064606, 30065262-30065283,30066244-30071110,30071186-30071374, 30071463-30071577,30072329-30073388,30074247-30074694, 30074966-30075019,30075105-30076898,30076989-30077949, 30078271-30078384,30078459-30078613,30078934-30079026, 30079341-30079613,30093423-30093975,30094465-30094540, 30094619-30094718 Length = 4025 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = +1 Query: 223 NRRFLERRLTEICSANVSVSPRMRCTDSAAHKCNYELFNRNNFS 354 N+R E + IC ++ + C D+ H C+ L + N + Sbjct: 1263 NKRVCEEWFSRICDPMLNAGLALHCNDAVIHYCSSRLLDIRNLA 1306 >10_08_0900 - 21436508-21437521 Length = 337 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -3 Query: 287 RGDTDTFAEHISVSRRSKKRRFNIKILSRCSSVSVE 180 R TD F EH+ V+ R + RF++ + R + +++ Sbjct: 54 RDTTDAFDEHLEVAVRRYQTRFSLPVTGRLDNATLD 89 >04_03_0150 + 11877714-11878487,11880928-11881245 Length = 363 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 446 RLRGLVRVPYRYFSSLPPRAGVGNLRACCLPWMWVAVSQA 565 R R + R P+R SSL PR G L + LP W+ + +A Sbjct: 99 RFRAVCR-PWRLSSSLHPRPQDGGLDSRFLPRHWIMLDKA 137 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 6.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 340 RNNFSIRYWSWNYRGC 387 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 >03_06_0180 + 32175658-32178145,32178765-32178808 Length = 843 Score = 27.5 bits (58), Expect = 8.6 Identities = 22/50 (44%), Positives = 26/50 (52%) Frame = +2 Query: 401 ALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLPPRAGVGNLRACCLPWMWV 550 ALQ LV ++ V + R R V V FSSLP A AC LPW W+ Sbjct: 76 ALQTRLVGMY-VLARRFRDAVAV----FSSLPRGAA-----ACALPWNWL 115 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,009,236 Number of Sequences: 37544 Number of extensions: 329866 Number of successful extensions: 731 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -