BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0654.Seq (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0053 + 14109636-14109948,14110075-14110302,14112030-141121... 29 2.3 03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700... 28 3.0 01_01_0148 - 1337494-1338057 27 9.2 >03_03_0053 + 14109636-14109948,14110075-14110302,14112030-14112181, 14112305-14112578,14112687-14112739 Length = 339 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 157 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSRFLARFEHS 279 P+ + YLG+ NK+ P+ Y + C K+ + F H+ Sbjct: 248 PIGCVPGYLGIFP-NKLSPKDYDVFGCIKWLNDFSKYHNHA 287 >03_03_0090 + 14367033-14367279,14367402-14368205,14368314-14370039, 14370135-14370219,14370398-14370457,14370744-14370836 Length = 1004 Score = 28.3 bits (60), Expect = 3.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 169 INHYLGVLKTNKIEPRSYSIIPCTKYSSRFLARFE 273 I H L +LK KI P +I C +YS ++ F+ Sbjct: 819 ILHALHILKAEKIFPTESNIADCIRYSEMNISGFD 853 >01_01_0148 - 1337494-1338057 Length = 187 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 68 DENTFGKCFR*CSSCDDP 121 DE G+CFR C +C DP Sbjct: 72 DELEPGQCFRQCEACRDP 89 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,818,793 Number of Sequences: 37544 Number of extensions: 198337 Number of successful extensions: 398 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -