BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0652.Seq (399 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1146 + 9087154-9087768 28 2.4 12_01_0670 + 5698852-5699061,5700894-5701316 26 9.5 >01_01_1146 + 9087154-9087768 Length = 204 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 304 ENAYXLTCYHVFHWSCAESKXRALPRTTLP 393 E L C HVFH +C ++ LPR T P Sbjct: 114 EEVRELRCRHVFHRACLDA-WLVLPRATCP 142 >12_01_0670 + 5698852-5699061,5700894-5701316 Length = 210 Score = 26.2 bits (55), Expect = 9.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 237 SSMAAXSDYNPICEICTKPLNEGECIXTYLLPCXS 341 S+ A D++P C+IC + C+ L C S Sbjct: 54 SAAAGDDDHHPTCDICQEKTGYFFCLEDRALLCRS 88 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,682,317 Number of Sequences: 37544 Number of extensions: 176349 Number of successful extensions: 419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -