BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0652.Seq (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 2.2 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 21 3.9 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 21 3.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 6.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 6.9 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 2.2 Identities = 14/52 (26%), Positives = 21/52 (40%) Frame = -1 Query: 210 ICNHTIFANIHSMFETKLICHSSLGTLTQAHFGFIFWYPAFTLKRNYLNSKH 55 IC I H++ +I L + Q W P ++RN LN +H Sbjct: 144 ICTSGIVGRTHTV--GYIIIGFLLAGIVQPFLIHWIWTPHGWMRRNVLNKQH 193 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 225 YTLWMICNHTIFAN 184 Y+L ++C H IF N Sbjct: 11 YSLALLCLHAIFVN 24 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 225 YTLWMICNHTIFAN 184 Y+L ++C H IF N Sbjct: 11 YSLALLCLHAIFVN 24 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 7 YLLNLSFVD 33 YLLN+SF+D Sbjct: 374 YLLNVSFID 382 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 Query: 7 YLLNLSFVD 33 YLLN+SF+D Sbjct: 464 YLLNVSFID 472 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,931 Number of Sequences: 438 Number of extensions: 2237 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -