Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0650.Seq
         (548 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    27   0.54 
AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         27   0.54 
AY534996-1|AAT07394.1|  471|Anopheles gambiae XK-related b protein.    26   0.94 
AF119382-1|AAD27585.1|  394|Anopheles gambiae caudal protein hom...    24   3.8  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          23   5.0  
AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger transc...    23   6.6  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    23   8.8  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    23   8.8  
AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific tran...    23   8.8  
AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless female-s...    23   8.8  

>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 26.6 bits (56), Expect = 0.54
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 4/42 (9%)
 Frame = +2

Query: 164 HFTPCYNNRQTS*AFVDVVGV----SLRMVHSRANHYLLCVI 277
           H+ P  +   +S  F+DV+ +     L  VH+ +NHYL  V+
Sbjct: 179 HYVPHISLNSSSSCFLDVLNLHELYQLNGVHNHSNHYLDLVL 220


>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 26.6 bits (56), Expect = 0.54
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +1

Query: 475 YHNLDHHHHHCFITRVAIIXMS 540
           +H   HHHHH  +T    + +S
Sbjct: 653 HHQQHHHHHHAEVTTAGSVRVS 674



 Score = 23.8 bits (49), Expect = 3.8
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 475 YHNLDHHHHH 504
           +H+  HHHHH
Sbjct: 652 HHHQQHHHHH 661


>AY534996-1|AAT07394.1|  471|Anopheles gambiae XK-related b protein.
          Length = 471

 Score = 25.8 bits (54), Expect = 0.94
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +1

Query: 427 VLVQLKRSWYLXFXFRYHNLDHHHHH 504
           VLV L+    L    +   L HHHHH
Sbjct: 264 VLVTLQSEAQLAAALKLKTLGHHHHH 289


>AF119382-1|AAD27585.1|  394|Anopheles gambiae caudal protein
           homolog protein.
          Length = 394

 Score = 23.8 bits (49), Expect = 3.8
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 481 NLDHHHHH 504
           NL HHHHH
Sbjct: 120 NLHHHHHH 127


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.4 bits (48), Expect = 5.0
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 472 RYHNLDHHHHH 504
           ++H+  HHHHH
Sbjct: 654 QHHHHHHHHHH 664


>AF395080-1|AAK97462.1|  537|Anopheles gambiae zinc finger
           transcription factor pannier protein.
          Length = 537

 Score = 23.0 bits (47), Expect = 6.6
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 475 YHNLDHHHHH 504
           +H+  HHHHH
Sbjct: 503 HHHHHHHHHH 512


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 22.6 bits (46), Expect = 8.8
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 478 HNLDHHHHH 504
           H+  HHHHH
Sbjct: 180 HSQHHHHHH 188


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 22.6 bits (46), Expect = 8.8
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +1

Query: 478 HNLDHHHHH 504
           H   HHHHH
Sbjct: 280 HQTHHHHHH 288


>AY785360-1|AAV52864.1|  759|Anopheles gambiae male-specific
           transcription factor FRU-MB protein.
          Length = 759

 Score = 22.6 bits (46), Expect = 8.8
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +1

Query: 478 HNLDHHHHH 504
           H   HHHHH
Sbjct: 280 HQTHHHHHH 288


>AY725820-1|AAU50568.1|  593|Anopheles gambiae fruitless
           female-specific zinc-fingerC isoform protein.
          Length = 593

 Score = 22.6 bits (46), Expect = 8.8
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +1

Query: 478 HNLDHHHHH 504
           H   HHHHH
Sbjct: 232 HQTHHHHHH 240


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 425,310
Number of Sequences: 2352
Number of extensions: 6919
Number of successful extensions: 28
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 50881347
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)