BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0648.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 2.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 2.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.5 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 6.2 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 6.2 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 6.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.1 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 473 LTPSVCYVETWPAKYDVKVQSINSN*GIVLD 381 LT +VC+V A + K SIN N + LD Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINENLKMGLD 220 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 473 LTPSVCYVETWPAKYDVKVQSINSN*GIVLD 381 LT +VC+V A + K SIN N + LD Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSINENLKMGLD 220 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 185 ENTGCCPVSCSNTLAARVSLSPDSP 111 ENT C P + S + + PD P Sbjct: 2280 ENTECHPDASSTMAPSTTPMVPDKP 2304 Score = 20.6 bits (41), Expect = 8.1 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +3 Query: 243 PLYSRGAKAEEILERGLKVREY 308 PLY + + +RGL + Y Sbjct: 2564 PLYGQSFSLADAADRGLNAKSY 2585 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 348 QNYPWRRSCHAA 313 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 348 QNYPWRRSCHAA 313 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 348 QNYPWRRSCHAA 313 Q YPW R H A Sbjct: 209 QIYPWMRKVHVA 220 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 8.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 292 KPLSRISSALAPRLYNGQQSFHY 224 KPL + R Y+ QQS HY Sbjct: 778 KPLVDAQTMNLLRSYHQQQSHHY 800 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,698 Number of Sequences: 336 Number of extensions: 2678 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -