BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0646.Seq (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9653| Best HMM Match : Retrotrans_gag (HMM E-Value=0.05) 34 0.085 SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_10714| Best HMM Match : Retrotrans_gag (HMM E-Value=5.4e-09) 33 0.20 SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.45 SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) 31 0.60 SB_52941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_11304| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_19127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49787| Best HMM Match : DUF1103 (HMM E-Value=4.4) 29 1.8 SB_35574| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_2877| Best HMM Match : Hom_end (HMM E-Value=1.1) 29 1.8 SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 29 1.8 SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) 29 2.4 SB_29068| Best HMM Match : Pec_lyase_N (HMM E-Value=3.5) 29 2.4 SB_2659| Best HMM Match : Pox_A32 (HMM E-Value=0.063) 29 2.4 SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_58548| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_54873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_51764| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 29 3.2 SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 29 3.2 SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) 29 3.2 SB_27320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_23010| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 29 3.2 SB_13928| Best HMM Match : DUF733 (HMM E-Value=8.4) 29 3.2 SB_9502| Best HMM Match : DUF1118 (HMM E-Value=6.5) 29 3.2 SB_7075| Best HMM Match : Hormone_5 (HMM E-Value=2.3) 29 3.2 SB_6350| Best HMM Match : Acyl_transf_1 (HMM E-Value=0.87) 29 3.2 SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) 29 3.2 SB_3847| Best HMM Match : Sec1 (HMM E-Value=8.8e-14) 29 3.2 SB_1331| Best HMM Match : POR_N (HMM E-Value=9) 29 3.2 SB_54542| Best HMM Match : Ribosomal_60s (HMM E-Value=0.39) 29 3.2 SB_47841| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 29 3.2 SB_47659| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_39805| Best HMM Match : Pec_lyase_N (HMM E-Value=3.5) 29 3.2 SB_37466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) 29 3.2 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) 29 3.2 SB_15988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_15807| Best HMM Match : Pec_lyase_N (HMM E-Value=3.5) 29 3.2 SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_35961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_7216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_5357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 28 4.2 SB_998| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_29823| Best HMM Match : Metallothio (HMM E-Value=2.6) 28 4.2 SB_24716| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_35588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_34045| Best HMM Match : Colicin (HMM E-Value=4) 28 5.6 SB_23091| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_14836| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_10024| Best HMM Match : Pox_A32 (HMM E-Value=3.3) 28 5.6 SB_57265| Best HMM Match : HTH_8 (HMM E-Value=1.2) 28 5.6 SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) 28 5.6 SB_34513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_32379| Best HMM Match : PsbQ (HMM E-Value=8.3) 28 5.6 SB_31201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 28 5.6 SB_53943| Best HMM Match : PsbQ (HMM E-Value=1.5) 27 7.3 SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) 27 7.3 SB_44505| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 27 7.3 SB_42707| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_40000| Best HMM Match : Pox_A32 (HMM E-Value=0.053) 27 7.3 SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) 27 7.3 SB_30991| Best HMM Match : DUF11 (HMM E-Value=2.9) 27 7.3 SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) 27 7.3 SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_19184| Best HMM Match : Pox_A32 (HMM E-Value=0.04) 27 7.3 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 27 7.3 SB_12591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_4600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_369| Best HMM Match : Pox_A32 (HMM E-Value=0.2) 27 7.3 SB_52337| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 27 7.3 SB_51873| Best HMM Match : PsbQ (HMM E-Value=3.9) 27 7.3 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_48825| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_45969| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.11) 27 7.3 SB_43635| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-08) 27 7.3 SB_43096| Best HMM Match : POR_N (HMM E-Value=4) 27 7.3 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_42674| Best HMM Match : DUF26 (HMM E-Value=1) 27 7.3 SB_38996| Best HMM Match : Pepsin-I3 (HMM E-Value=1.7) 27 7.3 SB_35831| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_31604| Best HMM Match : Pox_A32 (HMM E-Value=0.019) 27 7.3 SB_27019| Best HMM Match : rve (HMM E-Value=6.6e-15) 27 7.3 SB_24169| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 27 7.3 SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_21086| Best HMM Match : PsbQ (HMM E-Value=6.2) 27 7.3 SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) 27 7.3 SB_8786| Best HMM Match : rve (HMM E-Value=0.0029) 27 7.3 SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) 27 7.3 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_566| Best HMM Match : Keratin_B2 (HMM E-Value=9) 27 7.3 SB_473| Best HMM Match : Ribosomal_60s (HMM E-Value=0.97) 27 7.3 SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) 27 9.7 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 27 9.7 SB_34842| Best HMM Match : Rib_hydrolayse (HMM E-Value=6) 27 9.7 SB_10958| Best HMM Match : DUF733 (HMM E-Value=9.1) 27 9.7 SB_1075| Best HMM Match : rve (HMM E-Value=0.0089) 27 9.7 SB_30565| Best HMM Match : Metallothio (HMM E-Value=1.8) 27 9.7 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) 27 9.7 >SB_9653| Best HMM Match : Retrotrans_gag (HMM E-Value=0.05) Length = 626 Score = 33.9 bits (74), Expect = 0.085 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T ++ +P +AL TW AL L NH+ Sbjct: 138 LPLYHTGNASVWFNSHPRAALNTWDAALTQLKNHF 172 >SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2639 Score = 32.7 bits (71), Expect = 0.20 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T ++ +P +AL TW AL L NH+ Sbjct: 2541 LPLYLTGNASVWFNSHPRAALNTWDAALTQLKNHF 2575 >SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 32.7 bits (71), Expect = 0.20 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T ++ +P +AL TW AL L NH+ Sbjct: 220 LPLYLTGNASVWFNSHPRAALNTWDAALAQLKNHF 254 >SB_10714| Best HMM Match : Retrotrans_gag (HMM E-Value=5.4e-09) Length = 132 Score = 32.7 bits (71), Expect = 0.20 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T ++ +P +AL TW AL L NH+ Sbjct: 39 LPLYLTGNASVWFNSHPRAALNTWDAALTQLKNHF 73 >SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1958 Score = 32.3 bits (70), Expect = 0.26 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T ++ +P +AL TW AL L NH+ Sbjct: 1233 LPLYLTGNASVWFNGHPGAALNTWDAALTQLRNHF 1267 >SB_11160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 31.5 bits (68), Expect = 0.45 Identities = 17/65 (26%), Positives = 34/65 (52%) Frame = +3 Query: 84 HHPGNRDTVEVKNRKYNAASSESSYLNKDNDSISAGAHRAKSVEQSQDKSKYTSGPEACR 263 HHP RD + + + N+ +S + + + H+ ++E++ +++KY +GPE R Sbjct: 112 HHPW-RDRIAATSPRCNSTEDDSK---RKHTRPTFSGHQIFALEKTFEQTKYLAGPERAR 167 Query: 264 TAEGL 278 A L Sbjct: 168 LAYSL 172 >SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 31.1 bits (67), Expect = 0.60 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R + +P+GL A+R + R +L +TASPS+T Sbjct: 2 SVSDKLDPQRTLRIPLGLK---AERTAHRVTLNPSTASPSKT 40 >SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) Length = 882 Score = 31.1 bits (67), Expect = 0.60 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T + +P +AL TW AL L NH+ Sbjct: 118 LPLYLTGNASVRFNSHPRAALNTWDAALTQLKNHF 152 >SB_52941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 772 Score = 31.1 bits (67), Expect = 0.60 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY T ++ +P +A TW AL L NH+ Sbjct: 204 LPLYLTGNASVWFNSHPRAAFNTWDAALTQLKNHF 238 >SB_11304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 30.7 bits (66), Expect = 0.79 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +3 Query: 99 RDTVEVKNRKYNAASSESSYLNKDNDSISAGAHRAKSVEQSQDKSKYTSGP 251 RD KNR N + N++ D RAK E+++DK +Y P Sbjct: 339 RDRDRDKNRDKNRDRNREREKNRERDRRDRDRDRAKERERNRDKDRYRGKP 389 >SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 670 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 Query: 273 LPLYDTLLDQMYICFYPDSALRTWPGALRHLSNHY 169 LPLY ++ +P +AL TW AL L NH+ Sbjct: 16 LPLYLAGNASVWFNNHPRAALNTWDAALAQLKNHF 50 >SB_19127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1492 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R + R +L +TASP ET Sbjct: 1038 SVSDKLDPQRTPRIPLGLK---AERTAHRVTLNPSTASPGET 1076 >SB_49787| Best HMM Match : DUF1103 (HMM E-Value=4.4) Length = 450 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 19 SVSDKLDPQRTPRIPLGLK---AERIVHRVTLNPSTASPGET 57 >SB_35574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 230 KQIYIWSRSVSYSGRSQNYKDSKQAYADYHSDPNGGSASAGQSRDS 367 K+ Y+W S +G S NY+ A+Y P GG+ S G D+ Sbjct: 7 KKFYVWYTK-SNAGISSNYETCN---ANYVGQPGGGNQSFGNKEDA 48 >SB_2877| Best HMM Match : Hom_end (HMM E-Value=1.1) Length = 1250 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 623 SVSYKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 661 >SB_56091| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 914 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R SR +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVSRVTLNPSTASPGET 40 >SB_34512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1080 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 504 LTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 L P R + P+GL A+R R +L +TASP ET Sbjct: 7 LDPQRTIRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073) Length = 1387 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 695 SVSDKLNPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 733 >SB_29068| Best HMM Match : Pec_lyase_N (HMM E-Value=3.5) Length = 297 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -2 Query: 504 LTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 L P R +P+GL A+R R +L ++TASP ET Sbjct: 7 LDPQRTPRIPLGLK---AERTVHRVTLNSSTASPEET 40 >SB_2659| Best HMM Match : Pox_A32 (HMM E-Value=0.063) Length = 739 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 519 TTSIA--LTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 TTS++ L P R P+GL A+R R +L +TASP ET Sbjct: 68 TTSVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 108 >SB_59749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1091 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_58548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_54873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_51764| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 812 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 347 AGQSRDSSLRERNVHYVSDGEAVAASSDARDENRSANIM 463 AG++ DSS RE+N+ + ++SD +N S ++ Sbjct: 1016 AGENEDSSAREKNLEITRENSHKNSTSDLHSDNLSTIVI 1054 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 475 NWPEHYVGGSVFIAS-VTGSGHCFTVRDVMYVSLS 374 N H GGS+ V SGHCF R Y+ LS Sbjct: 270 NGTRHNCGGSLIDKQWVVTSGHCFDQRPYAYIPLS 304 >SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023) Length = 1640 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 551 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 589 >SB_27320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_23010| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 776 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_13928| Best HMM Match : DUF733 (HMM E-Value=8.4) Length = 158 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_9502| Best HMM Match : DUF1118 (HMM E-Value=6.5) Length = 393 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 23 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 61 >SB_7075| Best HMM Match : Hormone_5 (HMM E-Value=2.3) Length = 1259 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 451 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 489 >SB_6350| Best HMM Match : Acyl_transf_1 (HMM E-Value=0.87) Length = 721 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 482 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 520 >SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) Length = 1606 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_3847| Best HMM Match : Sec1 (HMM E-Value=8.8e-14) Length = 605 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 23 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 61 >SB_1331| Best HMM Match : POR_N (HMM E-Value=9) Length = 319 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_54542| Best HMM Match : Ribosomal_60s (HMM E-Value=0.39) Length = 1037 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_47841| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 351 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +3 Query: 96 NRDTVEVKNRKYNAASSESSYLNKDNDSISAGAHRAKSVEQSQDKSK 236 +R+T E + +K S E + + + G HR+K Q++ +S+ Sbjct: 116 SRETTEDRRKKTEEGSGEQQQNSSNESESTRGIHRSKQSRQAKHQSR 162 >SB_47659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLSPSTASPGET 40 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 5 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLSPSTASPGET 43 >SB_39805| Best HMM Match : Pec_lyase_N (HMM E-Value=3.5) Length = 611 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 157 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 195 >SB_37466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) Length = 718 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -1 Query: 475 NWPEHYVGGSVFIAS-VTGSGHCFTVRDVMYVSLS 374 N H GGS+ V SGHCF R Y+ LS Sbjct: 555 NGTRHNCGGSLIDKQWVVTSGHCFDQRPYAYIPLS 589 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPDET 40 >SB_17484| Best HMM Match : Pox_A32 (HMM E-Value=0.025) Length = 1616 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 374 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 412 >SB_15988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 82 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 120 >SB_15807| Best HMM Match : Pec_lyase_N (HMM E-Value=3.5) Length = 386 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_14194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R + P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTLRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_5898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRSPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_35961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 554 Score = 28.3 bits (60), Expect = 4.2 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 504 LTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 L P R +P+GL A+R R +L +TASP ET Sbjct: 7 LDPQRTPRIPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_7216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1400 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = -1 Query: 382 SLSQAAVARLSGRSRSAVRIAVIIGISLLGIFIVLRPSAVRHASGPDVYLLL 227 SL++ A GR + +I + G+SL+G+ + ++H SG Y+ L Sbjct: 680 SLTEGGAAEKDGRIQVNDQIIEVDGVSLVGVTQMFAAVTLKHTSGTVRYVHL 731 >SB_5357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 67 SVSDKLDPQRTPIIPLGLK---AERTVHRVTLNPSTASPEET 105 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRIPMGLK---AERTVHRVTLNPSTASPEET 40 >SB_998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTHRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_29823| Best HMM Match : Metallothio (HMM E-Value=2.6) Length = 812 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 504 SVSDKLDPQRTPIIPLGLK---AERTVHRVTLNPSTASPGET 542 >SB_24716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 894 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -1 Query: 412 CFTVRDVMYVSLSQAAVARLSGRSRSAVRIAVIIGISLLGIFIVLRPS 269 C V+++ S+ + + SGR +A + + + GI ++LRPS Sbjct: 598 CVLGVSVIFIMFSETPLVKASGRELTATLLIGLFLCYVEGIMLILRPS 645 >SB_35588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1474 Score = 27.9 bits (59), Expect = 5.6 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -2 Query: 525 SGTTSIA-LTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 S T IA L P + P+GL A+R R +L +TASP ET Sbjct: 350 SATDPIASLKPFSFATTPLGLK---AERTVHRVTLNPSTASPGET 391 >SB_34045| Best HMM Match : Colicin (HMM E-Value=4) Length = 366 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 504 LTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 L P R +P+GL A+R R +L +TASP ET Sbjct: 7 LDPQRTPIIPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_23091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 228 YPDSALRTWPGALRHLSNHY 169 +P +AL TW AL L NH+ Sbjct: 29 HPRAALNTWDAALTQLKNHF 48 >SB_14836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.6 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 6/78 (7%) Frame = +3 Query: 3 DPKTANMRFVLCCTLIALAALSVKAFGHHPGNRDTVEV------KNRKYNAASSESSYLN 164 D KT N R+V+C I LA + ++ +D +E KNR AAS S + Sbjct: 19 DVKTFN-RWVVC---IKLAKYGYQLLENYSETQDEMENLAFTLDKNRFPKAASFSVSARS 74 Query: 165 KDNDSISAGAHRAKSVEQ 218 +ND G HR + E+ Sbjct: 75 DENDESQVGTHRRLTAER 92 >SB_10024| Best HMM Match : Pox_A32 (HMM E-Value=3.3) Length = 651 Score = 27.9 bits (59), Expect = 5.6 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S + P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKIDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEET 40 >SB_57265| Best HMM Match : HTH_8 (HMM E-Value=1.2) Length = 274 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 415 HCFTVRDV-MYVSLSQAAVARLSGRSRSAVRIAVIIGISLLG 293 H FTV + + V+ AA+ R GRS S+V V IG+ +G Sbjct: 178 HGFTVTAIGLAVATKIAAIVRSFGRSLSSVARGVGIGLKAIG 219 >SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) Length = 2293 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 102 DTVEVKNRKYNAASSESSYLNKDNDSISAGAHRAKSVEQSQDKS 233 D + KN KY +S+ Y+NKD + +RA S + D+S Sbjct: 459 DVNKQKNEKYMNVASKDHYMNKDKEE-----NRANSDDDGNDES 497 >SB_34513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 415 HCFTVRDV-MYVSLSQAAVARLSGRSRSAVRIAVIIGISLLG 293 H TV + + V+ + AA+ R GRS S+V I V IG+ +G Sbjct: 150 HGSTVTAIGLAVATTIAAIVRSLGRSLSSVAIGVGIGLKAIG 191 >SB_32379| Best HMM Match : PsbQ (HMM E-Value=8.3) Length = 270 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP ET Sbjct: 2 SVSNKLDPQRTPRLPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_31201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 27.9 bits (59), Expect = 5.6 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = -1 Query: 412 CFT-VRDVMYVSLSQAAVARLSGRSRSAVRIAVIIGISLLGIFIVLRPSAVRHA 254 C T V+ + + LS+ AV SR+AVR+A+I+ + + + ++L +A+R A Sbjct: 57 CITDVKLRLALILSRNAVRLALILSRNAVRLALILSRNAVRLALILSRNAIRRA 110 >SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1144 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 239 YIWSRSVSYSGRSQNYKDSKQAYADYHSDPNGGSASAGQSRDSS 370 Y S + Y+G S YK K + + S + G S SRDS+ Sbjct: 227 YAGSSNAKYAGSSSMYKARKNSNSSSSSFGDAGYISGNGSRDSN 270 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 27.9 bits (59), Expect = 5.6 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLVPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_53943| Best HMM Match : PsbQ (HMM E-Value=1.5) Length = 540 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_52513| Best HMM Match : MAGP (HMM E-Value=0.12) Length = 1020 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 864 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 902 >SB_44505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 197 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 235 >SB_42707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_40000| Best HMM Match : Pox_A32 (HMM E-Value=0.053) Length = 946 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) Length = 1497 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 563 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 601 >SB_30991| Best HMM Match : DUF11 (HMM E-Value=2.9) Length = 707 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 426 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 464 >SB_24318| Best HMM Match : Pox_A32 (HMM E-Value=0.029) Length = 598 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_19215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_19184| Best HMM Match : Pox_A32 (HMM E-Value=0.04) Length = 540 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_12591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 571 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPERTSRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_4600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 119 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 157 >SB_369| Best HMM Match : Pox_A32 (HMM E-Value=0.2) Length = 856 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_52337| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 591 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_51873| Best HMM Match : PsbQ (HMM E-Value=3.9) Length = 271 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 539 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 577 >SB_48825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.5 bits (58), Expect = 7.3 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = +2 Query: 254 SVSYSGRSQNYKDSKQAYADYHSDPNGGSASAGQSRDSSLRERNVHYVSDGEAVAASSDA 433 SV ++ + KDS+ DY N S +G +R S S+ +A SDA Sbjct: 277 SVDVRSKTPSNKDSELIPLDYKVPDNTPSTPSGPARSRSRTPSRPPSFSNLHTLAEGSDA 336 Query: 434 RDE 442 +E Sbjct: 337 EEE 339 >SB_45969| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.11) Length = 735 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_43635| Best HMM Match : 7tm_1 (HMM E-Value=7.3e-08) Length = 237 Score = 27.5 bits (58), Expect = 7.3 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = -1 Query: 397 DVMYVSLSQAAVARLSGRSRSAVRIAVIIGISLLGI---FIVLRPSAVRHASGPDVYLLL 227 D + +L + +++R G +R + V+I + L+G+ +VLR + + G +YL + Sbjct: 7 DERFNALQENSLSR--GTARVVIESLVVIILCLIGLIGNILVLRIVKNKRSEGKMIYLFI 64 Query: 226 S*LCSTDLARCA 191 L TD++ A Sbjct: 65 GALALTDVSLLA 76 >SB_43096| Best HMM Match : POR_N (HMM E-Value=4) Length = 480 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 1015 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 1053 >SB_42674| Best HMM Match : DUF26 (HMM E-Value=1) Length = 493 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 420 LPVTLAMKTDPPT*CSGQLER*RXFTELALSKWFR 524 LP++ M T PPT + +ER T+ AL +W + Sbjct: 84 LPLSTLMATLPPTSTAHDVERLSTGTKFALRQWLK 118 >SB_38996| Best HMM Match : Pepsin-I3 (HMM E-Value=1.7) Length = 865 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_35831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 647 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_31604| Best HMM Match : Pox_A32 (HMM E-Value=0.019) Length = 802 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_27019| Best HMM Match : rve (HMM E-Value=6.6e-15) Length = 684 Score = 27.5 bits (58), Expect = 7.3 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R ++ +TASP ET Sbjct: 2 SVSDKLDPQRTTRTPLGLK---AERTVHRVTINPSTASPGET 40 >SB_24169| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 591 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_21086| Best HMM Match : PsbQ (HMM E-Value=6.2) Length = 260 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_13336| Best HMM Match : Pox_A32 (HMM E-Value=0.049) Length = 960 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_8786| Best HMM Match : rve (HMM E-Value=0.0029) Length = 946 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_7884| Best HMM Match : rve (HMM E-Value=2.1e-15) Length = 813 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A R R +L +TASP ET Sbjct: 1406 SVSDKLDPQRTPRIPLGLK---AKRTVHRVTLNPSTASPGET 1444 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A R R +L +TASP ET Sbjct: 1043 SASDKLDPQRKPRIPLGLK---AKRTVHRVTLNPSTASPGET 1081 >SB_3752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_566| Best HMM Match : Keratin_B2 (HMM E-Value=9) Length = 258 Score = 27.5 bits (58), Expect = 7.3 Identities = 20/70 (28%), Positives = 29/70 (41%) Frame = +3 Query: 39 CTLIALAALSVKAFGHHPGNRDTVEVKNRKYNAASSESSYLNKDNDSISAGAHRAKSVEQ 218 CT I L A K P T + K ++ + +E+ +D+D S G VE Sbjct: 62 CTCIPLLATQKKIMESIPNKHRTPD-KRKRPGSPIAETKEQYEDSDKSSTGHEGQICVET 120 Query: 219 SQDKSKYTSG 248 D + TSG Sbjct: 121 DPDITMETSG 130 >SB_473| Best HMM Match : Ribosomal_60s (HMM E-Value=0.97) Length = 757 Score = 27.5 bits (58), Expect = 7.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R P+GL A+R R +L +TASP ET Sbjct: 2 SVSDKLDPQRTPRTPLGLK---AERTVHRVTLNPSTASPGET 40 >SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) Length = 937 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P + +P+GL A+R R +L +TASP ET Sbjct: 86 SVSDKLDPQQTPRIPLGLK---AERSVHRVTLNPSTASPEET 124 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP E+ Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEES 40 >SB_34842| Best HMM Match : Rib_hydrolayse (HMM E-Value=6) Length = 421 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R + +TASP ET Sbjct: 2 SVSDKLDPKRTPRIPLGLK---AERTVHRVTFNPSTASPEET 40 >SB_10958| Best HMM Match : DUF733 (HMM E-Value=9.1) Length = 268 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P + +P+GL A+R R +L +TASP ET Sbjct: 82 SVSDKLDPQQTPRIPLGLK---AERTVHRVTLNPSTASPEET 120 >SB_1075| Best HMM Match : rve (HMM E-Value=0.0089) Length = 1617 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P + +P+GL A+R R +L +TASP ET Sbjct: 421 SVSDKLDPQQTPRIPLGLK---AERSVHRVTLNPSTASPEET 459 >SB_30565| Best HMM Match : Metallothio (HMM E-Value=1.8) Length = 565 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P + +P+GL A+R R +L +TASP ET Sbjct: 177 SVSDKLDPQQTPRIPLGLK---AERTVHRVTLNPSTASPGET 215 >SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 96 NRDTVEVKNRKYNAASSESSYLNKDNDSISA-GAHRAKSV 212 +RDT E + +K S E NK N+S S G HR+ V Sbjct: 233 SRDTTEDRRKKTEEGSGEQQQ-NKSNESESTRGIHRSNRV 271 >SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) Length = 511 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -2 Query: 519 TTSIALTP*RXVSVPIGLSIMLADRFSSRASLEAATASPSET 394 + S L P R +P+GL A+R R +L +TASP E+ Sbjct: 2 SVSDKLDPQRTPRIPLGLK---AERTVHRVTLNPSTASPEES 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,655,392 Number of Sequences: 59808 Number of extensions: 305536 Number of successful extensions: 1081 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -