BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0644.Seq (489 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 1.4 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 7.4 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 9.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 22 9.8 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 22 9.8 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 22 9.8 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.0 bits (52), Expect = 1.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 246 SRVGFFMWRAKRDTEIGGRLIRLIKSRRRTI 154 +RVG +W +K E R + IKS+RR + Sbjct: 266 ARVGLELWGSKSIGECTQRQLDNIKSKRRVV 296 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 22.6 bits (46), Expect = 7.4 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 170 LFMSRINRPPISVSRLARHMKKPTRE--GLMPW*WGQSQMT*DCTRYR 307 +F ++NR I+ L MKKP R+ L P + Q T + T +R Sbjct: 1065 VFTDQVNRHTITRLLLNEAMKKPDRQFCFLTPQDMSEVQATAELTIHR 1112 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.2 bits (45), Expect = 9.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 229 HVARQTRHRDWWPVDTAHKEPA*NDLIEFGICTSGQVSVKL 107 ++ RQ D W T K+P +D I TS S++L Sbjct: 580 YLVRQFDRADQWMEYTYTKDPLTDDYQLSAISTSNTASLQL 620 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.2 bits (45), Expect = 9.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 Query: 229 HVARQTRHRDWWPVDTAHKEPA*NDLIEFGICTSGQVSVKL 107 ++ RQ D W T K+P +D I TS S++L Sbjct: 581 YLVRQFDRADQWMEYTYTKDPLTDDYQLSAISTSNTASLQL 621 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 276 DCPHYHGIKPSRV 238 +C H+HG PS V Sbjct: 368 NCNHHHGFHPSTV 380 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 22.2 bits (45), Expect = 9.8 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 Query: 279 CDCPHYHGIKPSRV 238 C PHY + P RV Sbjct: 496 CSVPHYEPLDPERV 509 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,974 Number of Sequences: 2352 Number of extensions: 8751 Number of successful extensions: 18 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -