BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0643.Seq (568 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0901 - 7094953-7095231,7095337-7095522,7095785-7096285 31 0.48 08_02_1360 + 26391141-26391287,26392256-26392627,26393372-26393860 29 2.0 05_01_0428 - 3379116-3379262,3379357-3379537,3379690-3379785,337... 29 2.6 10_08_0959 - 21813756-21814097,21814462-21814570,21814688-218147... 28 6.0 11_06_0220 - 21374816-21376849 27 7.9 >01_01_0901 - 7094953-7095231,7095337-7095522,7095785-7096285 Length = 321 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +3 Query: 93 LNALSTYLKVLFSQLQLKNLIVVKNWYKKYSHSVASALMALSVLSVYQSPRT 248 ++ ST +++LFSQ+ + N + K + + SH VASA++ + +Y + T Sbjct: 209 IHVSSTSIQILFSQIAIANGQLEKFYQPRSSHHVASAIVHGEKIPLYGAGET 260 >08_02_1360 + 26391141-26391287,26392256-26392627,26393372-26393860 Length = 335 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = +1 Query: 460 IWYRNWTKSVCICTELSVTDNRYSGTPRSGR 552 +W+RN + + I ++++V ++ Y+G P S R Sbjct: 178 MWFRNPLRHIAITSDIAVANDYYNGDPESLR 208 >05_01_0428 - 3379116-3379262,3379357-3379537,3379690-3379785, 3379886-3380034,3380120-3380392,3380895-3380983, 3381923-3382015,3382143-3382238,3382370-3382477, 3382917-3383208 Length = 507 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 28 QYNKITIYNIFKQKCL 75 QYN+I IYNI+ KCL Sbjct: 284 QYNQIDIYNIYAPKCL 299 >10_08_0959 - 21813756-21814097,21814462-21814570,21814688-21814740, 21814849-21815049,21815320-21815433,21815513-21815671, 21816490-21816849,21816928-21817149,21817967-21818093, 21818887-21819023,21819169-21819292,21819665-21820174, 21820255-21820436,21820812-21820862,21821114-21821266, 21821339-21821437,21821519-21821861,21821957-21822030, 21822105-21823025,21823133-21823257,21823419-21823461, 21823574-21823762,21824814-21825074,21825228-21825387, 21826200-21826363,21826523-21827009,21827090-21827431, 21827519-21827836,21828001-21828041,21828136-21828388, 21829158-21829261,21830198-21830386,21830543-21831196, 21831320-21831610,21831739-21831882,21832107-21832205, 21832549-21832657,21832739-21832923,21833008-21833121, 21833270-21833401,21833483-21833815,21833945-21834436, 21834773-21834847,21834917-21835066,21835143-21835241, 21835463-21835547,21837188-21837375,21837513-21837647, 21837729-21837849,21838127-21838194,21838275-21838370, 21838450-21838554,21838665-21838980,21839053-21839142, 21840011-21840181,21840850-21841010,21841088-21841270, 21841839-21841940,21842515-21842632,21842704-21842798, 21842972-21843022,21843107-21843241,21843333-21843436, 21844249-21844414,21844649-21844773,21845220-21845316 Length = 4181 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 87 VFLNALSTYLKVLFSQLQLKNLIVVKNWYKKYSHSVASALMALSVLSVY 233 V ++A +++VLF + +L V YK + VA+ + L LSV+ Sbjct: 56 VLVSAPQQFIQVLFGDCESTHLDAVTRHYKSIALRVATVIQNLGNLSVW 104 >11_06_0220 - 21374816-21376849 Length = 677 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 557 NGRPDLGVPLYRLSVTDSSVQIQTDLV 477 NGRPD + L+R VT+S+V + ++ Sbjct: 300 NGRPDSALKLFRWMVTNSTVLVTRSIL 326 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,915,445 Number of Sequences: 37544 Number of extensions: 263363 Number of successful extensions: 425 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -