BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0642.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef... 89 5e-19 SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef... 89 5e-19 SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef... 89 5e-19 SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa... 42 7e-05 SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote... 32 0.055 SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Sc... 25 4.8 SPBC20F10.05 |||DuF1740 family protein|Schizosaccharomyces pombe... 25 6.3 SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|... 25 8.4 >SPAC23A1.10 |ef1a-b||translation elongation factor EF-1 alpha Ef1a-b |Schizosaccharomyces pombe|chr 1|||Manual Length = 460 Score = 88.6 bits (210), Expect = 5e-19 Identities = 46/78 (58%), Positives = 54/78 (69%) Frame = -2 Query: 483 EXVDRRYW*IYXKSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAV 304 E +DRR +S PK +KSGDA I +V KP+CVE+F ++ PLGRFAVRDMRQTVAV Sbjct: 375 EKIDRRSGKKIEES-PKFVKSGDACIAKMVPSKPMCVEAFTDYAPLGRFAVRDMRQTVAV 433 Query: 303 GVIKAVNFKEAGGGKVIK 250 GVIKAV G KV K Sbjct: 434 GVIKAVEKVAPGAAKVTK 451 >SPCC794.09c |ef1a-a||translation elongation factor EF-1 alpha Ef1a-a |Schizosaccharomyces pombe|chr 3|||Manual Length = 460 Score = 88.6 bits (210), Expect = 5e-19 Identities = 46/78 (58%), Positives = 54/78 (69%) Frame = -2 Query: 483 EXVDRRYW*IYXKSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAV 304 E +DRR +S PK +KSGDA I +V KP+CVE+F ++ PLGRFAVRDMRQTVAV Sbjct: 375 EKIDRRSGKKIEES-PKFVKSGDACIAKMVPSKPMCVEAFTDYAPLGRFAVRDMRQTVAV 433 Query: 303 GVIKAVNFKEAGGGKVIK 250 GVIKAV G KV K Sbjct: 434 GVIKAVEKVAPGAAKVTK 451 >SPBC839.15c |ef1a-c||translation elongation factor EF-1 alpha Ef1a-c |Schizosaccharomyces pombe|chr 2|||Manual Length = 460 Score = 88.6 bits (210), Expect = 5e-19 Identities = 46/78 (58%), Positives = 54/78 (69%) Frame = -2 Query: 483 EXVDRRYW*IYXKSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAV 304 E +DRR +S PK +KSGDA I +V KP+CVE+F ++ PLGRFAVRDMRQTVAV Sbjct: 375 EKIDRRSGKKIEES-PKFVKSGDACIAKMVPSKPMCVEAFTDYAPLGRFAVRDMRQTVAV 433 Query: 303 GVIKAVNFKEAGGGKVIK 250 GVIKAV G KV K Sbjct: 434 GVIKAVEKVAPGAAKVTK 451 >SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 41.5 bits (93), Expect = 7e-05 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVG-VIKAVN 283 K P G I L P+C+E F+++ +GRF +RD TVAVG V+K ++ Sbjct: 607 KKPPMFATKGMKIIAELETQTPVCMERFEDYQYMGRFTLRDQGTTVAVGKVVKILD 662 >SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 592 Score = 31.9 bits (69), Expect = 0.055 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -2 Query: 384 PLCVESFQEFPPLGRFAVRDMRQTVAVGVIK 292 PLC+ +E P LGRF +R TVA G++K Sbjct: 561 PLCLA--EECPALGRFILRRSGDTVAAGIVK 589 >SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Schizosaccharomyces pombe|chr 2|||Manual Length = 388 Score = 25.4 bits (53), Expect = 4.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +2 Query: 254 MTLPPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKDST 376 + L P +S + TP+AT S+ + P GG D+T Sbjct: 244 LNLKPRSSSNVNTEATPSATTTTSSKPKRDPFGGAKPVDNT 284 >SPBC20F10.05 |||DuF1740 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 25.0 bits (52), Expect = 6.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -3 Query: 161 GVSKEKRATNSFLFYIFYKACNVTLFYNLYKV 66 G S E S+ IFY FYNL KV Sbjct: 762 GASSEMECYFSYCSLIFYYQATTLQFYNLPKV 793 >SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 24.6 bits (51), Expect = 8.4 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 227 QEVARAVNSTIFHTTAILHSPKGVSKEKRATNSFL 123 + +A A+N +I TT + K + E+ ++ SFL Sbjct: 369 EALAYAINPSILPTTLLTSYQKSIQDEENSSVSFL 403 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,769,328 Number of Sequences: 5004 Number of extensions: 30946 Number of successful extensions: 90 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -