BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0642.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ... 88 4e-18 At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ... 88 4e-18 At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ... 88 4e-18 At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ... 88 4e-18 At1g35550.1 68414.m04414 elongation factor Tu C-terminal domain-... 79 2e-15 At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,... 45 3e-05 At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E... 40 0.001 At4g27900.2 68417.m04005 expressed protein 32 0.25 At4g27900.1 68417.m04004 expressed protein 32 0.25 At1g55420.1 68414.m06339 DC1 domain-containing protein contains ... 29 2.3 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 28 4.0 At2g04500.1 68415.m00455 DC1 domain-containing protein contains ... 27 7.0 >At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha identical to SWISS-PROT:P13905 elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana] Length = 449 Score = 87.8 bits (208), Expect = 4e-18 Identities = 40/66 (60%), Positives = 51/66 (77%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAG 268 + PK +K+GDA +V + KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+ K+ Sbjct: 376 EKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPT 435 Query: 267 GGKVIK 250 G KV K Sbjct: 436 GAKVTK 441 >At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 87.8 bits (208), Expect = 4e-18 Identities = 40/66 (60%), Positives = 51/66 (77%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAG 268 + PK +K+GDA +V + KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+ K+ Sbjct: 376 EKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPT 435 Query: 267 GGKVIK 250 G KV K Sbjct: 436 GAKVTK 441 >At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 87.8 bits (208), Expect = 4e-18 Identities = 40/66 (60%), Positives = 51/66 (77%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAG 268 + PK +K+GDA +V + KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+ K+ Sbjct: 376 EKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPT 435 Query: 267 GGKVIK 250 G KV K Sbjct: 436 GAKVTK 441 >At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha identical to GB:CAA34456 from [Arabidopsis thaliana] (Plant Mol. Biol. 14 (1), 107-110 (1990)) Length = 449 Score = 87.8 bits (208), Expect = 4e-18 Identities = 40/66 (60%), Positives = 51/66 (77%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAG 268 + PK +K+GDA +V + KP+ VE+F E+PPLGRFAVRDMRQTVAVGVIK+V+ K+ Sbjct: 376 EKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPT 435 Query: 267 GGKVIK 250 G KV K Sbjct: 436 GAKVTK 441 >At1g35550.1 68414.m04414 elongation factor Tu C-terminal domain-containing protein similar to SP|P13905 Elongation factor 1-alpha (EF-1-alpha) {Arabidopsis thaliana}; contains Pfam profile PF03143: Elongation factor Tu C-terminal domain Length = 104 Score = 79.0 bits (186), Expect = 2e-15 Identities = 34/63 (53%), Positives = 47/63 (74%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVNFKEAG 268 + PK +K+ +AAI+N+ KP+ VE++ +PPLGRFA+RDMRQTV VGVIK+V K+ Sbjct: 42 EKEPKFLKNSEAAIINMTPTKPMVVEAYSAYPPLGRFAIRDMRQTVGVGVIKSVVKKDPS 101 Query: 267 GGK 259 G K Sbjct: 102 GAK 104 >At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein, putative similar to EF-1-alpha-related GTP-binding protein gi|1009232|gb|AAA79032 Length = 532 Score = 44.8 bits (101), Expect = 3e-05 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -2 Query: 429 IKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 295 +K+G A + + +C+E F +FP LGRF +R +T+AVG + Sbjct: 478 VKNGAAVVCRIQVTNSICIEKFSDFPQLGRFTLRTEGKTIAVGKV 522 >At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / EF-1-alpha, putative contains similarity to SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha) [Aeropyrum pernix] Length = 667 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = -2 Query: 447 KSNPKSIKSGDAAIVNLVXXKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAV 286 K +P+ + + +A++ + P+CVE+F E LGR +R +TVA+G + + Sbjct: 610 KKSPRCLTAKQSAMLEVSLQNPVCVETFSESRALGRVFLRSSGRTVAMGKVTRI 663 >At4g27900.2 68417.m04005 expressed protein Length = 261 Score = 31.9 bits (69), Expect = 0.25 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -2 Query: 438 PKSIKSGDAAIVNLVXXKPLCVESFQEFPPL 346 PKS+ SG+ + +++V K ++ F +FPP+ Sbjct: 144 PKSVSSGNLSSMDMVEHKDAVIQGFPDFPPV 174 >At4g27900.1 68417.m04004 expressed protein Length = 261 Score = 31.9 bits (69), Expect = 0.25 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -2 Query: 438 PKSIKSGDAAIVNLVXXKPLCVESFQEFPPL 346 PKS+ SG+ + +++V K ++ F +FPP+ Sbjct: 144 PKSVSSGNLSSMDMVEHKDAVIQGFPDFPPV 174 >At1g55420.1 68414.m06339 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 725 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -3 Query: 116 IFYKACN---VTLFYNLYKVIHNI--SETFCYDCKLKC 18 I+ K C+ V LFY ++ N S FCY C+L+C Sbjct: 619 IYLKPCHIFKVGLFYKEVEIARNDGNSRLFCYICRLRC 656 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Frame = -3 Query: 116 IFYKACN---VTLFYNLYKVIHNI--SETFCYDCKLKC 18 I+ K C+ V L+Y ++ N S FCY C+L+C Sbjct: 579 IYLKPCHIFKVGLYYKEVEIARNDGNSRLFCYTCELRC 616 >At2g04500.1 68415.m00455 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 495 Score = 27.1 bits (57), Expect = 7.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 62 HNISETFCYDCKLKCKF 12 + ++ FC+ C+L+CKF Sbjct: 444 NGVTRPFCFHCELRCKF 460 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,178,584 Number of Sequences: 28952 Number of extensions: 160210 Number of successful extensions: 425 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -