BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0639.Seq (459 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F3.06c |lon1||Lon protease homolog Lon1|Schizosaccharomyce... 25 7.3 SPBC2G2.13c |||deoxycytidylate deaminase |Schizosaccharomyces po... 24 9.7 >SPAC22F3.06c |lon1||Lon protease homolog Lon1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1067 Score = 24.6 bits (51), Expect = 7.3 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 251 LYHKFRQDYTIKNISKDKQYLIYSQFDN*RQEQKFAINSMHACVRQY 391 L HK ++ K + K+YL+ Q ++E ++S A V ++ Sbjct: 430 LQHKINKEIEQKITQRHKEYLLTEQLKQIKRELGQELDSKEALVTEF 476 >SPBC2G2.13c |||deoxycytidylate deaminase |Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 24.2 bits (50), Expect = 9.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 Query: 419 KEDITHTTYHIDEHT 375 KE + HT+Y++D HT Sbjct: 312 KEVVYHTSYNMDSHT 326 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,562,475 Number of Sequences: 5004 Number of extensions: 27022 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -