BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0639.Seq (459 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78542-6|CAB01749.2| 695|Caenorhabditis elegans Hypothetical pr... 27 6.6 Z78062-4|CAB01498.2| 341|Caenorhabditis elegans Hypothetical pr... 27 6.6 >Z78542-6|CAB01749.2| 695|Caenorhabditis elegans Hypothetical protein F20D1.7 protein. Length = 695 Score = 27.1 bits (57), Expect = 6.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 251 LYHKFRQDYTIKNISKDKQYLI 316 LY+ FR Y + N+S DK+YLI Sbjct: 566 LYNMFRS-YNLVNLSADKEYLI 586 >Z78062-4|CAB01498.2| 341|Caenorhabditis elegans Hypothetical protein F16D3.6 protein. Length = 341 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 153 AIKTNVLILRRFSRHFKNIQVPKTRNVLTLIIAS 52 AI N +ILR F +HF+NIQ + + +L+I S Sbjct: 211 AIIVNFVILR-FVKHFENIQSKRIQLTQSLLIQS 243 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,596,274 Number of Sequences: 27780 Number of extensions: 149525 Number of successful extensions: 286 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 820565746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -