BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0638.Seq (479 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 28 4.5 09_06_0151 - 21237677-21237704,21237759-21237829,21238101-212382... 27 6.0 12_02_1262 + 27415191-27415279,27415367-27415565,27415635-274157... 27 7.9 02_05_0602 + 30283893-30284170,30286259-30286305,30286534-302875... 27 7.9 02_03_0065 - 14629676-14629804,14631119-14631247,14631383-146317... 27 7.9 >01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 Length = 5436 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +2 Query: 104 ESINYVTE--SIPQKHYTEIYKMNPSESEQRIVNKQINFDD 220 E N+ E S+P K+YTE K+N E+ +K + D Sbjct: 843 EKTNFTPEKSSVPGKNYTEFEKLNDEGEEEEQNDKIVTLKD 883 Score = 27.5 bits (58), Expect = 6.0 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +2 Query: 104 ESINYVTE--SIPQKHYTEIYKMNPSESEQRIVNKQINFDDAL-ETELADSDTI 256 E IN+++E S P+K YT K N EQ +K +D E L +D++ Sbjct: 1160 EEINFMSEKFSDPKKFYTRFEKENDKIEEQEENDKSSTLNDKKDENTLEHTDSV 1213 >09_06_0151 - 21237677-21237704,21237759-21237829,21238101-21238281, 21238369-21238441,21239033-21239072,21239818-21239890, 21240075-21240151,21241033-21241138,21241256-21241278, 21241369-21241440 Length = 247 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = +2 Query: 140 KHYTEIYKMNPSESEQRIVNKQ--INFDDALETELADSDTIQKIVFQRRVLCQN 295 +HY EIYK P S +VNK D + + + +T + VLC N Sbjct: 103 QHYIEIYK--PIHSRANVVNKTKIAGLHDKGKATILEIETTTHVKDSGEVLCMN 154 >12_02_1262 + 27415191-27415279,27415367-27415565,27415635-27415775, 27415939-27416003,27416111-27416489,27416688-27417149, 27417226-27417546,27418184-27418501 Length = 657 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -1 Query: 392 PKLSTL--YDSDGTTLGTLXVKEPXKSCSYLRL 300 P+LS+L D + GTL V+ P KSC +L L Sbjct: 203 PRLSSLPLIPIDQDSSGTLSVQVPQKSCRFLSL 235 >02_05_0602 + 30283893-30284170,30286259-30286305,30286534-30287510, 30287611-30287920,30288561-30290197 Length = 1082 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 39 NILIKAVHQTVDTKSKHHTNIPKALTTLQNQYHRN 143 ++L AV+ + K H +N+P+ + LQ YH + Sbjct: 224 DMLTNAVNSMPNRKYFHDSNMPRLVEFLQGMYHES 258 >02_03_0065 - 14629676-14629804,14631119-14631247,14631383-14631736, 14631817-14632063,14632155-14632231,14632574-14632648, 14632721-14632822,14632966-14633084,14633538-14633627, 14634866-14635022,14635085-14635098,14635425-14635548, 14635628-14635678,14635793-14635891,14636962-14637072 Length = 625 Score = 27.1 bits (57), Expect = 7.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 42 ILIKAVHQTVDTKSKHHTN 98 +L+ VH+ D + KHHTN Sbjct: 507 LLVVIVHEAQDVEGKHHTN 525 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,692,389 Number of Sequences: 37544 Number of extensions: 182552 Number of successful extensions: 435 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -