BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0635.Seq (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47600.1 68415.m05939 magnesium/proton exchanger (MHX1) ident... 29 1.5 At4g14605.1 68417.m02247 mitochondrial transcription termination... 29 1.9 At2g31740.1 68415.m03876 expressed protein 27 7.7 >At2g47600.1 68415.m05939 magnesium/proton exchanger (MHX1) identical to magnesium/proton exchanger AtMHX [Arabidopsis thaliana] gi|6492237|gb|AAF14229; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 539 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 73 IKQLWAAQPTYIISQAVYVLAGLLTLFHAFKKGGRWPYFWL 195 I ++W+ ++ + VL L L HA+ + RWPY L Sbjct: 187 ILEVWSPNVITLVEALLTVLQYGLLLVHAYAQDKRWPYLSL 227 >At4g14605.1 68417.m02247 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 444 Score = 28.7 bits (61), Expect = 1.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 222 CVNPMKYGTEPKIRPSSAFFKSM 154 C N M Y E K+RP+ +F+S+ Sbjct: 327 CPNIMSYSVEDKLRPTMEYFRSL 349 >At2g31740.1 68415.m03876 expressed protein Length = 760 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 120 RLRFGWPLNIISCF*KRRKMALFL 191 R RFGW +N+ S KR K+ ++ Sbjct: 191 RFRFGWKMNVHSIAQKRSKLKTYM 214 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,592,175 Number of Sequences: 28952 Number of extensions: 218844 Number of successful extensions: 470 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -