BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0634.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.05c |rer1||Rer1 family protein|Schizosaccharomyces pom... 28 0.90 SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription fact... 25 4.8 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 6.3 SPBC36.03c |||spermidine family transporter |Schizosaccharomyces... 25 6.3 SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schiz... 25 8.4 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 25 8.4 >SPAC22E12.05c |rer1||Rer1 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 184 Score = 27.9 bits (59), Expect = 0.90 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 222 LVAHLVLSGYRARRHLQH--KCRHLPSDISSK 311 +V +LVLS + RR +QH K R++P DI K Sbjct: 148 VVYYLVLSFFCFRRQIQHMLKYRYVPFDIGKK 179 >SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription factor Grt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 648 Score = 25.4 bits (53), Expect = 4.8 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Frame = +3 Query: 162 KFTINVIVFVFFLSIRY--VDELVAHLVLSGYRARRHLQ---HKCRHLPSDISSK 311 + +++ I VFF+S+ + + + SG R L HKC++ +D+S K Sbjct: 248 ELSLDAIRIVFFMSVSAGNLGDTALSYLYSGTAVRMSLAIGLHKCKNFSNDLSDK 302 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 25.0 bits (52), Expect = 6.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 385 FCHEAVINAFRFDGWGSR 332 +C+E IN + WGSR Sbjct: 2005 YCYEGPINNYMIKSWGSR 2022 >SPBC36.03c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 538 Score = 25.0 bits (52), Expect = 6.3 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +2 Query: 320 FYSTTAAPSVEPKRINYCFMAEMGSGLTRGPTTSYFANYNFAG 448 F+S A S P + A+M TRGP FA FAG Sbjct: 194 FFSGFCASS--PLSVVAAAFADMFDNKTRGPAVCIFACITFAG 234 >SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schizosaccharomyces pombe|chr 1|||Manual Length = 504 Score = 24.6 bits (51), Expect = 8.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 261 YEPGNHLTPGGPRVRL 214 Y+P H TPGGP++ L Sbjct: 363 YKPKLHGTPGGPKLSL 378 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 24.6 bits (51), Expect = 8.4 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 308 QGLSFYSTTAAPSVEPKRINYCFMAEMGSGLTRGPTTSYFANYNF 442 QGL+ A +V + N + +GSG+ + T+Y ANY+F Sbjct: 1902 QGLTASEAVAKGAVGWNQTN----SSIGSGIIQPRDTNYTANYSF 1942 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,756,684 Number of Sequences: 5004 Number of extensions: 30253 Number of successful extensions: 95 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -