BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0634.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 27 0.47 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 24 2.5 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 24 2.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 3.3 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 23 4.4 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.6 bits (56), Expect = 0.47 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 210 YVDELVAHLVLSGYRARRHLQHKCRHLPSDISSKVSAFTVQRLPHPSNRNAL 365 Y DE+ A + L + HL+HK +H I ++A + + P N +L Sbjct: 395 YADEMSASIGLEPHAHLNHLRHKSKH---PIPINMNADDMNNILAPGNMGSL 443 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 24.2 bits (50), Expect = 2.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 499 LAIDFNSEGIAPRNKNQTRKIIICEITG 416 L+I + EG+ + RK ++C ITG Sbjct: 121 LSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 276 YVVDVYEPGNHLTPGGPR 223 Y++D Y PG+ L P P+ Sbjct: 74 YLIDAYRPGHTLYPNIPK 91 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 3.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 213 VDELVAHLVLSGYRARRHLQHKCRHLPS 296 VD L+A +LSG+R R H C PS Sbjct: 918 VDFLLAQ-ILSGHRFFREFLHVCGFAPS 944 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 23.4 bits (48), Expect = 4.4 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 313 SQLLQYNGCPIRRTETH*LLLHGRNGQRTHKRS 411 SQL + C R TET L GR TH R+ Sbjct: 39 SQLTRSRYCGRRLTETLAFLCQGRYPMLTHYRT 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 452,218 Number of Sequences: 2352 Number of extensions: 7947 Number of successful extensions: 54 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -