BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0632.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62870.1 68414.m07099 expressed protein 31 0.43 At1g32190.1 68414.m03959 expressed protein 31 0.43 At3g46050.1 68416.m04983 kelch repeat-containing F-box family pr... 30 0.75 At2g34940.1 68415.m04289 vacuolar sorting receptor, putative sim... 30 0.75 At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nea... 30 1.00 At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea... 30 1.00 At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea... 30 1.00 At2g31955.1 68415.m03903 molybdopterin biosynthesis protein, put... 29 1.3 At2g22140.1 68415.m02630 expressed protein ; expression supporte... 28 3.0 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 28 4.0 At3g29210.1 68416.m03664 hypothetical protein similar to At1g328... 28 4.0 At2g14720.2 68415.m01657 vacuolar sorting receptor, putative ide... 28 4.0 At2g14720.1 68415.m01656 vacuolar sorting receptor, putative ide... 28 4.0 At4g11910.1 68417.m01894 expressed protein hypothetical protein ... 27 5.3 At3g27580.1 68416.m03446 protein kinase, putative similar to ser... 27 5.3 At5g54370.1 68418.m06770 late embryogenesis abundant protein-rel... 27 7.0 At1g69100.1 68414.m07907 aspartyl protease family protein contai... 27 7.0 At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein... 27 9.3 At4g21590.1 68417.m03126 bifunctional nuclease, putative similar... 27 9.3 At3g22640.1 68416.m02858 cupin family protein contains similarit... 27 9.3 At2g18470.1 68415.m02151 protein kinase family protein contains ... 27 9.3 >At1g62870.1 68414.m07099 expressed protein Length = 796 Score = 31.1 bits (67), Expect = 0.43 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 375 TPHPPSPANSSHRGREGGRDCTLHYHRHN 289 +P PP P +SSHR R L++H H+ Sbjct: 120 SPSPPPPPSSSHRKRNSSAVEALNHHHHH 148 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 31.1 bits (67), Expect = 0.43 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 145 CPTSRCDDQSSCPKPASADCPAPACKC 225 C + C SCPKP CP P+C C Sbjct: 296 CCSGLCRPSCSCPKPR---CPKPSCSC 319 Score = 26.6 bits (56), Expect = 9.3 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = +3 Query: 291 CDGDNEEYNPCP-PLCPGESCSQATEDGECHRVGRIGIVLPCKPAC-RCKKYFWRQDGVC 464 C G CP P CP SCS G+C G P C C K C Sbjct: 297 CSGLCRPSCSCPKPRCPKPSCSCGCGCGDC---GCFKCSCPTLKGCFSCCKKPSCVSSCC 353 Query: 465 VPYEQCKEC 491 P +C C Sbjct: 354 CPTFKCSSC 362 >At3g46050.1 68416.m04983 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 370 Score = 30.3 bits (65), Expect = 0.75 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 460 TPSCLQKY--FLHLQAGLHGNTMPILPTRWHSPSSVACEQLSP 338 T SC+ K FL++ LH N P P RW S + ++L P Sbjct: 60 TRSCIGKTESFLYVCLDLHRNCYPDCPPRWFIVSPITKQKLKP 102 >At2g34940.1 68415.m04289 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 618 Score = 30.3 bits (65), Expect = 0.75 Identities = 25/84 (29%), Positives = 32/84 (38%), Gaps = 9/84 (10%) Frame = +3 Query: 273 ECPPFD-CDGDNEEYNPCPPLCPGESCSQATEDGECHRVGRIGIVLP-CKPA----CRCK 434 ECP D + Y C P P CS +G+C R G+ C + CRC Sbjct: 444 ECPVVDGVQYKGDGYTSCKPYGPAR-CSM--NNGDCWSETRKGLTFSSCSDSETSGCRCP 500 Query: 435 KYFWRQDGVCVPYEQCKE---CSC 497 F C ++CKE C C Sbjct: 501 LGFLGDGLKCEDIDECKEKSACKC 524 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 76 VTEPPCADSEILD-KCPVDCPSDYCPTSRCDDQSSCPKPASADCPAPACKCRFNY 237 +T C+DSE +CP+ D +C+D C K SA C CKC+ N+ Sbjct: 484 LTFSSCSDSETSGCRCPLGFLGDGL---KCEDIDEC-KEKSA-CKCDGCKCKNNW 533 >At3g52850.1 68416.m05824 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog (GP:1737218) [Arabidopsis thaliana] Length = 623 Score = 29.9 bits (64), Expect = 1.00 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 79 TEPPCADSEILD-KCPVDCPSDYCPTSRCDDQSSCPKPASADCPAPACKCR 228 T C D D KCP+ D C+D C + C P CKC+ Sbjct: 484 TYSACVDDHSKDCKCPLGFKGD--GVKNCEDVDECKEKTVCQC--PECKCK 530 >At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.9 bits (64), Expect = 1.00 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 91 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACK 222 C D + + KC +CP + T +C+D + C + + CP +CK Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGTKKCEDINECKEKKACQCPECSCK 535 >At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 29.9 bits (64), Expect = 1.00 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 91 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACK 222 C D + + KC +CP + T +C+D + C + + CP +CK Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGTKKCEDINECKEKKACQCPECSCK 535 >At2g31955.1 68415.m03903 molybdopterin biosynthesis protein, putative / molybdenum cofactor biosynthesis enzyme, putative 3' fragment; strong similarity to SP|Q39055 Molybdopterin biosynthesis CNX2 protein (Molybdenum cofactor biosynthesis enzyme CNX2) {Arabidopsis thaliana} Length = 390 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 344 LTGAERGAGIVLFIITVTIKGRAFSSRYACPLVARL 237 L G+E G+G V IT T R FSS YA V ++ Sbjct: 22 LVGSEVGSGSVTRTITTTTSERLFSSSYAAHQVDQI 57 >At2g22140.1 68415.m02630 expressed protein ; expression supported by MPSS Length = 506 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 220 CRLALDSRRSQASDSLTGHRIGSLDSNQKDSPR 122 C + S D +G RI SLDS +DSPR Sbjct: 69 CSFGSRALASNREDKFSGKRIISLDSEFEDSPR 101 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 171 VKLSEACERRLSSASLQM*IQLQTRNQRTCIPT 269 V SEAC +L+S S ++L N+R C+ T Sbjct: 802 VDFSEACPTKLASGSDDCSVKLWNINERNCLGT 834 >At3g29210.1 68416.m03664 hypothetical protein similar to At1g32840, At4g04010, At2g06430, At2g15140, At2g04980, At2g14130, At3g44500, At2g15190, At3g47260, At5g34900, At2g02210, At3g32900 Length = 594 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = +3 Query: 192 ERRLSSASLQM*IQLQTRNQRTCIPTRECPPFDCDGDNEEYNPCP 326 ++++ SA + + + + +N++ I + D DGDN+++ P P Sbjct: 507 QKQVDSADVDVPTRKEAQNKKRKIIGNDGDNADNDGDNDDFQPAP 551 >At2g14720.2 68415.m01657 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 91 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACK 222 C D + + KC +CP + +C+D + C + + CP +CK Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGVKKCEDINECKEKKACQCPECSCK 535 >At2g14720.1 68415.m01656 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 91 CADSEILDKCPVDCPSDYCP--TSRCDDQSSCPKPASADCPAPACK 222 C D + + KC +CP + +C+D + C + + CP +CK Sbjct: 493 CVDKDSV-KC--ECPPGFKGDGVKKCEDINECKEKKACQCPECSCK 535 >At4g11910.1 68417.m01894 expressed protein hypothetical protein F7H19.100 -Arabidopsis thaliana,PID:e1310060 Length = 466 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 309 EYNPCPPLCP-GESCSQATEDGECHRVGRIGIVLPCKPACRC 431 EYN P E+ SQ DG H+ LPC C+C Sbjct: 191 EYNKVECWGPLWEAMSQHQHDGRTHKKSETLPELPCPDECKC 232 >At3g27580.1 68416.m03446 protein kinase, putative similar to serine/threonine protein kinase [Arabidopsis thaliana] gi|217861|dbj|BAA01715 Length = 578 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 136 SDYCPTSRCDDQSSCPKPASADCPAPAC 219 S YC C DQSSC DC P C Sbjct: 351 SSYCIQPTCVDQSSC--IVQPDCIQPVC 376 >At5g54370.1 68418.m06770 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein (GI:1350543)[Picea glauca] Length = 337 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 115 KCPVDCPSDYCPTSRCDDQSSCPKPASADCPAPACKCRFNYRR 243 +CP +CPS S+ K ADC P CK + R+ Sbjct: 42 RCPEECPSKTAMNSK-------NKVCYADCDRPTCKSQCRMRK 77 >At1g69100.1 68414.m07907 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 343 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -1 Query: 328 GGQGLYSSLSPSQSKGGHSLVGMHV---RWLRVCS*IYI 221 GGQ ++ P Q KG H V M + RW S IYI Sbjct: 177 GGQIMFGGFDPKQFKGEHVYVPMKLSDDRWKIKMSKIYI 215 >At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein contains PF01422: NF-X1 type zinc finger Length = 912 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 390 FQHDGTPHPPSPANS-SHRGREGGRDCTLHYHRHN 289 F+ P PPS S + G D H HRHN Sbjct: 12 FRWKSPPQPPSQEQPISDSDSDSGSDSENHQHRHN 46 >At4g21590.1 68417.m03126 bifunctional nuclease, putative similar to bifunctional nuclease [Zinnia elegans] gi|4099833|gb|AAD00694 Length = 294 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 166 DQSSCPKPASADCPAPACKCRFNYRRATNGHA---YRLENALPLI 291 +Q++CP P +++ ACK + YR AT G Y + LP++ Sbjct: 224 NQTACPNPYASESIDLACK--YAYRNATAGTTLGDYYFVSRLPVV 266 >At3g22640.1 68416.m02858 cupin family protein contains similarity to vicilin-like protein precursor [Juglans regia] GI:6580762, vicilin precursor [Theobroma cacao] PIR|S22477, vicilin precursor [Macadamia integrifolia] GI:5852872 Length = 486 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -1 Query: 424 QAGLHGNTMPILPTRWHSPSSVACEQLSPGQRGGQGLYSSLSPSQSK 284 Q+ +G T +L T ++ P + ++ + GQG+ +SP Q K Sbjct: 200 QSYFNGFTKEVLSTSFNVPEELLGRLVTRSKEIGQGIIRRISPDQIK 246 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +1 Query: 58 ADATDDVTEP-PCADSEILDKCPVDCPSDYCPTSRCDDQSSCPKPASADCPAP 213 A T+ + P P +++ P PS PT D SS P P S PAP Sbjct: 8 APPTNSTSSPSPPSNTNSTTSSP-PAPSPPSPTPPQGDSSSSPPPDSTSPPAP 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,897,920 Number of Sequences: 28952 Number of extensions: 279467 Number of successful extensions: 926 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -