BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0631.Seq (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 23 7.9 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 7.9 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -2 Query: 315 CFQESSFRREQTFTQAWSRKICLCFENIFDIPY 217 C + ++F+ E+ T +R C C E +PY Sbjct: 45 CTRVATFKGERFCTLCDTRHFCECKETREPLPY 77 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.6 bits (46), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 414 FHLKHVRGKHNHFRQFFYLGRF 349 FHL V H +FR++ ++ F Sbjct: 923 FHLSQVLTGHGYFREYLHVCGF 944 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,563 Number of Sequences: 2352 Number of extensions: 9529 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -