BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0630.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 68 4e-12 SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) 31 0.70 SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) 29 1.6 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) 29 2.1 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 29 2.1 SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) 29 2.8 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 28 3.7 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 4.9 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_4930| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 6.5 SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) 27 8.6 SB_24238| Best HMM Match : RecR (HMM E-Value=3.7) 27 8.6 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) 27 8.6 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 27 8.6 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 68.1 bits (159), Expect = 4e-12 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 362 MRGAFGKPQGTVXRVRIGQXIMSVRSSDRWKAQVIEALXLAKFKFP 499 MRGAFGKPQGTV RV IGQ I+S+R+ D KA IEAL AKFKFP Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFP 46 >SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) Length = 730 Score = 30.7 bits (66), Expect = 0.70 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 319 IDADNVERVKSHADMELILSAVFTRYLLQQIRPASKASELSCSYSSDTK 173 + A+ V+R+ SH M+ + S + Y +PA+K + L C Y+ K Sbjct: 16 LTAERVQRLLSHTRMKEV-SRICKVYFSSDTKPAAKTNNLLCQYNEIKK 63 >SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) Length = 718 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 25 GAGQQDATGTAKINRIRNRGSVGVYLIPRSVSSIWVRRERPLTTF 159 G G T N++ +G V LIP+ +I VR +P T+F Sbjct: 313 GNGTACYTVEGSFNQLAGKGYVEAALIPKGARNIRVREVKPCTSF 357 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 216 PKPLSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQ 100 PK SS V+ RT AR ++R++ Y ++YG W Q Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331 >SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) Length = 650 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 244 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 113 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 252 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 294 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 244 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 113 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 1020 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 1062 >SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) Length = 1023 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -3 Query: 413 QCEHVXQYPEACQTHHASQSGAYQLQRMITFY*CG*RGKGEVSCGYG 273 +C V Q P AC + S GA + Y C K V CG G Sbjct: 535 KCPDVTQAPVACTNGYYSGDGATECTLCPAGYSCADATKSPVPCGKG 581 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +3 Query: 48 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQLSSEALEAGR 227 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 228 IC 233 +C Sbjct: 500 MC 501 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 370 CVWQASGYCXTCSHWTXHHV 429 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 27.9 bits (59), Expect = 4.9 Identities = 10/38 (26%), Positives = 25/38 (65%) Frame = +3 Query: 246 LVKTAERISSISA*DFTLSTLSASIKCYHALELIGSRL 359 L+ + +++ ++ D T+ST + ++C + ++L+G RL Sbjct: 726 LICSKQKLRKLAGKDLTVSTENGQLECVNEVKLLGIRL 763 >SB_4930| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 1127 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 226 RPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 113 R +S+ S+ SC+ S + SGK + LF KS+ R Sbjct: 983 RKSSRTSQRSCASSMSSSSAESGKLEQLNLFDGKSRKR 1020 >SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) Length = 520 Score = 27.1 bits (57), Expect = 8.6 Identities = 10/38 (26%), Positives = 25/38 (65%) Frame = +3 Query: 246 LVKTAERISSISA*DFTLSTLSASIKCYHALELIGSRL 359 L+ + ++ +++ D T+ST + ++C + ++L+G RL Sbjct: 466 LICSKPKLRTLTGKDLTVSTENGQLECVNEVKLLGIRL 503 >SB_24238| Best HMM Match : RecR (HMM E-Value=3.7) Length = 153 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 198 AVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQVHP 91 A+ TP+ R E+RQR+ ++ RR S D ++P Sbjct: 102 AIFTLATPNRRPTETRQRAANTPSARRPSSPDVINP 137 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 27.1 bits (57), Expect = 8.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 195 QLSSEALEAGRICCNKYLVKTAERIS 272 +L S A E+ + N YLVK ER+S Sbjct: 64 ELKSRAFESSSVFYNPYLVKEKERLS 89 >SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) Length = 177 Score = 27.1 bits (57), Expect = 8.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 278 IRMRLHPFHVIRINKMLS 331 +RM +HP H IRIN ++S Sbjct: 134 VRMSVHPLHPIRINGVVS 151 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.1 bits (57), Expect = 8.6 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -2 Query: 207 LSSAVHIRRTP--SARTVESRQRSLSSYPNRRYGSWDQVHPDRTSISDT 67 LS ++I P S SR +S P R + +HPD S SDT Sbjct: 140 LSDTLNISHQPIASLSVCSSRILCISPVPGARLIGLETIHPDADSKSDT 188 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,420,218 Number of Sequences: 59808 Number of extensions: 377933 Number of successful extensions: 1157 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -