BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0629.Seq (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) 33 0.096 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 31 0.51 SB_32477| Best HMM Match : DUF593 (HMM E-Value=0.41) 31 0.51 SB_46754| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-29) 29 1.2 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 1.6 SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23) 28 2.7 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 28 2.7 SB_45938| Best HMM Match : Troponin (HMM E-Value=1) 28 2.7 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 28 3.6 SB_46824| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 27 4.8 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 27 4.8 SB_43027| Best HMM Match : U79_P34 (HMM E-Value=0.066) 27 4.8 SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) 27 8.3 SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_38431| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_32685| Best HMM Match : RCSD (HMM E-Value=0.18) 27 8.3 SB_30105| Best HMM Match : PLA2_B (HMM E-Value=1.7e-06) 27 8.3 SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 27 8.3 SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12722| Best HMM Match : Oxysterol_BP (HMM E-Value=1.2) 27 8.3 SB_5359| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_32795| Best HMM Match : tRNA_anti (HMM E-Value=4.8e-11) 27 8.3 SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_57943| Best HMM Match : SCP (HMM E-Value=5.70048e-42) Length = 632 Score = 33.1 bits (72), Expect = 0.096 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 254 TKTGKRD-GSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSEP 409 T KR G K + + K ESN++SREF+ ++ + ++ RD NR + SEP Sbjct: 193 TPVHKRQFGEKDTKSEYKGKWESNRRSREFDKEDFKGNS-RDINRLWENRSEP 244 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 30.7 bits (66), Expect = 0.51 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 269 RDGSKSGVTVEREKSESNKKSREFENKEAESSTY 370 RDG GVT++ E N K RE ENK+ E Y Sbjct: 2937 RDGQFRGVTIQLEADIENYK-RELENKDLECQGY 2969 >SB_32477| Best HMM Match : DUF593 (HMM E-Value=0.41) Length = 214 Score = 30.7 bits (66), Expect = 0.51 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 269 RDGSKSGVTVEREKSESNKKSREFENKEAESSTY 370 RDG GVT++ E N K RE ENK+ E Y Sbjct: 80 RDGQFRGVTIQLEADIENYK-RELENKDLECQGY 112 >SB_46754| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-29) Length = 487 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSEP 409 R+K E +K RE + E ESS R+K +S EP Sbjct: 195 RKKREEARKRREEKLAEKESSKSRNKRKSKEQRDEP 230 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 29.1 bits (62), Expect = 1.6 Identities = 17/59 (28%), Positives = 28/59 (47%) Frame = +2 Query: 227 RDRNQ*IIRTKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGS 403 RDRN+ + +++ K ER+K +K +E E +E E R+K R + S Sbjct: 613 RDRNREKENDREREKEREKEKEKEERDKEREKEKEKEKE-REKEKEREREKERDRDKSS 670 >SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23) Length = 422 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 174 GSDDSDKNRGKDTDDKYSETGTNKSSERR 260 G +S+K TD++ SETG +SE+R Sbjct: 384 GLKESEKGVDSGTDERMSETGEESASEQR 412 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.3 bits (60), Expect = 2.7 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 257 KTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 K GK+D S+S E+ K++ +K RE + KE + + ++ R E Sbjct: 791 KKGKKDSSES----EKGKAKKQRKGREKKGKEIKKNDDEEEERDEEEDDE 836 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 28.3 bits (60), Expect = 2.7 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 230 DRNQ*IIRTK-TGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 D NQ I K TGK G ++EK+ S S + +++ ST KN + ++G++ Sbjct: 733 DANQENITGKMTGKNGSESPGGEPKKEKNVSQAASNVDKEQKSSGSTSDSKNTNSSNGNK 792 >SB_45938| Best HMM Match : Troponin (HMM E-Value=1) Length = 185 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 296 VEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 +E + ES + R ENK AE+ Y D+ S E Sbjct: 49 LEESERESRSRQRVLENKLAEAKAYNDQLESEREDME 85 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +2 Query: 251 RTKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSEPHE 415 +TK G++ +ER+K+E +K R+ E +E++ ++K E E Sbjct: 1032 KTKEGEKKMKDEQDEIERKKAEEEEKKRK-EEEESKKKDEKEKEEEDEDEEEEEE 1085 >SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 2.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETGTNKSSE 254 +D++DKN D +D Y+ G N +++ Sbjct: 264 NDNNDKNDNNDNNDNYNNNGNNDNND 289 Score = 27.1 bits (57), Expect = 6.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETGTNKSSE 254 +D++D N D +D Y GTN +++ Sbjct: 184 NDNNDNNDNYDNNDNYDNNGTNDNND 209 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 251 RTKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 +T+ +K +ERE SE+N K+RE E + RD+ +GS+ Sbjct: 631 KTQVTTEVSTKQKDALERELSEANGKNRELEEACENLAGIRDELEKELAGSK 682 >SB_46824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +2 Query: 257 KTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGS 403 K +D S + + + +N ++ +NK++ ++ R+KN + N+ S Sbjct: 18 KRNSKDSSINKASYNNSINGNNNNNKSNDNKDSNNNNDRNKNNNNNNNS 66 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 189 DKNRGKDTDDKYSETGTNKSSERRQASVMARRAASQSKGKNPNPTR 326 D+NRGKD + Y + N ++RR + + R+ S+ + P+R Sbjct: 146 DRNRGKDRRENYDD---NYEADRRPSDRRSERSRSRRGEWDETPSR 188 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +2 Query: 257 KTGKRDGSKSGVTVEREKSESNKKSRE---FENKEAESSTYRDKNR 385 K K + + +R+KSE ++SRE K+ +SS +RDK + Sbjct: 210 KAEKSERKREKEEKKRDKSEKRERSRERSKDRKKDRDSSKHRDKEK 255 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETGTNKSSERRQASVMARRAASQSKGKNPNP 320 S ++N +D DD+ + + + S R+ R + + +G++P+P Sbjct: 415 SRSRERNMARDRDDRRPPSRSRRDSSLRRQRSPLRNRSPRWRGRSPSP 462 >SB_43027| Best HMM Match : U79_P34 (HMM E-Value=0.066) Length = 443 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = +2 Query: 251 RTKTGKRDGSKSGVTVERE---KSESNKKSREFENKEAESSTYRDKNRSXNSGSEP 409 R+++ R+ SK ++E K + K ++ + K+ E S +DK++ + +EP Sbjct: 197 RSRSRDREKSKEPENEKKEDKRKDSAKSKGKDGDRKKREDSGKKDKDKENDKENEP 252 >SB_34145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 679 Score = 27.1 bits (57), Expect = 6.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 186 SDKNRGKDTDDKYSETGTNKSSERRQASVMARRAASQS 299 S + + KD+DD S + TN SS+ + +R + S Sbjct: 163 SPEKKDKDSDDSSSNSNTNVSSDEKSPKADRKRPKTTS 200 >SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) Length = 1311 Score = 26.6 bits (56), Expect = 8.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 299 EREKSESNKKSREFENKEAESSTYRDKN 382 E+E E++KK+ E ENK+ S+ D + Sbjct: 822 EKEGKEADKKTEEKENKDESSNKLTDND 849 >SB_38518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1399 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 213 DDKYSETGTNKSSERRQASVMARRAASQSKGKNPNPTR 326 D S +G +K RR++ + + ++S+SK PN R Sbjct: 1303 DSSTSRSGVSKEPARRESFMDSLFSSSKSKSNQPNTKR 1340 >SB_38431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETGTNKSSERRQASVMARRAASQSKGKNPNPTR 326 SDDSDK + D+ S T T ++E + S+ + P+ R Sbjct: 897 SDDSDKTECQSDDNMQSNTETEPANEAQSPDQEVDNIECDSQKQQPSTRR 946 >SB_34510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1845 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETGTNKSSERRQASVMARRAASQSKG 305 S D++++RGK + K ++ ++ ER + + ARR S+G Sbjct: 1214 SHDAERSRGKGRNGKQTQRPKAQNKERDKHAKEARRKGILSEG 1256 >SB_32685| Best HMM Match : RCSD (HMM E-Value=0.18) Length = 530 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 171 TGSDDSDKNRGKDTDDKYSETGTNKS 248 TG+DD+D G TDD S TGT+ + Sbjct: 483 TGTDDTDSPTG--TDDTDSHTGTDNT 506 >SB_30105| Best HMM Match : PLA2_B (HMM E-Value=1.7e-06) Length = 380 Score = 26.6 bits (56), Expect = 8.3 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETGTNKSSERRQASVM 275 ++DSD + D+D+K + +N ++ Q+ +M Sbjct: 343 NEDSDDEQASDSDEKDAAKNSNGDDDKEQSKLM 375 >SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 177 SDDSDKNRGKDTDDKYSETG 236 +DD D N G D DD TG Sbjct: 18 NDDGDNNNGDDEDDDLDNTG 37 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 290 VTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSEP 409 V +E ++ KK E + + S RD+ S +SGS P Sbjct: 1790 VQPNQEPNKRRKKPPHLETRLSASRANRDRGHSSSSGSPP 1829 >SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1323 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +2 Query: 269 RDGSKSGVTVE--REKSESNKKSREFENKEAESSTYRDKNRSXNS 397 +D S+S + E RE+ E KK+++ + +++ ++ + N+S +S Sbjct: 241 KDSSESSIDSEDDRERKERKKKNKKEKKHKSKETSSSESNKSSDS 285 >SB_12722| Best HMM Match : Oxysterol_BP (HMM E-Value=1.2) Length = 640 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/49 (26%), Positives = 28/49 (57%) Frame = +2 Query: 266 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSEPH 412 +++G +G + +REK S++K + E++E + RD++R + H Sbjct: 379 EKNGRSNG-SPKREKHRSDRKRDKEESRERDRDRDRDRDRDRDRDRGKH 426 >SB_5359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 281 KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 K+ + EK E+N+K++ N + DKN+ N+ E Sbjct: 6 KTDSKIAEEKPENNEKAQAEINNAGPTDAKTDKNKEKNAKEE 47 >SB_54200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 26.6 bits (56), Expect = 8.3 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +3 Query: 174 GSDDSDKNRGKDTDDKYSETGTNKSSERRQASVMARRAASQS 299 G D+ D+ GK+ + E ++ SS+R ++ ++A+ S Sbjct: 890 GKDEKDEKEGKEGKEDKDEKDSDGSSQRPSLDLVVQQASDGS 931 >SB_32795| Best HMM Match : tRNA_anti (HMM E-Value=4.8e-11) Length = 305 Score = 26.6 bits (56), Expect = 8.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 314 ESNKKSREFENKEAESSTYRDKN 382 + +KS E E KEAE + R+KN Sbjct: 130 QEKRKSEEREKKEAEKAQQREKN 152 >SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 26.6 bits (56), Expect = 8.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 180 DDSDKNRGKDTDDKYSETGTNKSSE 254 D++D N D +D Y G N S++ Sbjct: 197 DNNDNNDNNDNNDNYDNNGNNDSND 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,147,713 Number of Sequences: 59808 Number of extensions: 127005 Number of successful extensions: 934 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -