BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0629.Seq (419 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 4.3 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 4.3 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 4.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 4.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 4.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 5.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 20 9.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 20 9.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 20 9.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 20 9.9 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 35 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 77 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 268 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 310 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = +2 Query: 278 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 S+ + RE+ + K++ K E+S R +NR+ S+ Sbjct: 268 SRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERERSK 310 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 5.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 210 TDDKYSETGTNKSSERRQASVMARRAASQS 299 TD+ E GTNK+ + S +R S+S Sbjct: 233 TDNSRLEPGTNKNGKFFSRSSTSRIVISES 262 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 43 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 77 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 43 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 77 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 43 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 77 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 43 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 77 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 276 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 276 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 276 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 276 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 276 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 310 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 7.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 302 REKSESNKKSREFENKEAESSTYRDKNRSXNSGSE 406 RE+ + K+ K E+S R +NR+ S+ Sbjct: 265 REREQKLYKNEREYRKYGETSKERSRNRTEREKSK 299 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.2 bits (40), Expect = 9.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 305 EKSESNKKSREFENKE 352 EKS S +SRE++ K+ Sbjct: 1 EKSCSRDRSREYKKKD 16 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 308 KSESNKKSREFENKEAESSTYRD 376 KS S K + NK++ S Y+D Sbjct: 480 KSSSINKLEDLRNKKSCHSGYKD 502 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 308 KSESNKKSREFENKEAESSTYRD 376 KS S K + NK++ S Y+D Sbjct: 480 KSSSINKLEDLRNKKSCHSGYKD 502 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 9.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 308 KSESNKKSREFENKEAESSTYRD 376 KS S K + NK++ S Y+D Sbjct: 480 KSSSINKLEDLRNKKSCHSGYKD 502 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,545 Number of Sequences: 438 Number of extensions: 1519 Number of successful extensions: 27 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -