BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0622.Seq (488 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. 23 5.6 AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. 23 5.6 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 7.4 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 22 9.8 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 22 9.8 >AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 23.0 bits (47), Expect = 5.6 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -3 Query: 159 IKEDPDISNHFNKPRTQCGNGSWKTKRDFI 70 + P+I+NH ++P+ + S F+ Sbjct: 29 LSTQPEITNHLDRPKVTMADNSSSLDAQFV 58 >AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 23.0 bits (47), Expect = 5.6 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -3 Query: 159 IKEDPDISNHFNKPRTQCGNGSWKTKRDFI 70 + P+I+NH ++P+ + S F+ Sbjct: 29 LSTQPEITNHLDRPKVTMADNSSSLDAQFV 58 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.6 bits (46), Expect = 7.4 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 341 KKLTQIYRHASQAIRTYILREINRKDKTCFISDPTHMKSL 460 KK+T + + Q IR E R+DK D H + L Sbjct: 117 KKMTSTWENTVQNIRDKKEAERLRRDKAKVEEDQRHYREL 156 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 22.2 bits (45), Expect = 9.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 354 KYIDMRHKQLGPIFYERLTGKTKLALSATQLT 449 K + + + L P FY + GKT + L LT Sbjct: 6 KLLALLQRPLEPTFYPKDDGKTVVDLPENYLT 37 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 22.2 bits (45), Expect = 9.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 156 KEDPDISNHFNKPRTQCGNGSWKTKR 79 + DP I N+ T C WKTK+ Sbjct: 230 RRDPPI----NRQHTPCAGRRWKTKQ 251 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,147 Number of Sequences: 2352 Number of extensions: 9125 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -