BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0617.Seq (489 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00520-1|AAA17932.1| 125|Homo sapiens immunoglobulin heavy chai... 31 2.1 AK092226-1|BAC03832.1| 391|Homo sapiens protein ( Homo sapiens ... 29 6.5 >U00520-1|AAA17932.1| 125|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 125 Score = 31.1 bits (67), Expect = 2.1 Identities = 21/66 (31%), Positives = 28/66 (42%) Frame = +2 Query: 56 SASNSRHQEQTPYKYTESINYVTESIPQKHYTEIYKMNPSESEQRIVNKQINFDDALETE 235 S S+ Q P K E I+Y++E+ KHY + K + S N D T Sbjct: 29 SGSSMNWVRQAPGKRLEYISYISETSQTKHYADSVKGRVTISRDNAKNSL----DLQMTS 84 Query: 236 LADSDT 253 L D DT Sbjct: 85 LRDEDT 90 >AK092226-1|BAC03832.1| 391|Homo sapiens protein ( Homo sapiens cDNA FLJ34907 fis, clone NT2RI2003392. ). Length = 391 Score = 29.5 bits (63), Expect = 6.5 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 6/34 (17%) Frame = -1 Query: 114 LMLSVYLY---GVC---SWCRLFDALL*SIYCTL 31 L SVY + G+C SWCR FD LL S C L Sbjct: 113 LTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVL 146 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,146,164 Number of Sequences: 237096 Number of extensions: 1163614 Number of successful extensions: 6113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6113 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4366354454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -