BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0616.Seq (488 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. 23 4.2 AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. 23 4.2 AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. 23 4.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 4.2 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 5.6 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 5.6 AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. 23 7.4 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 7.4 AJ302662-1|CAC35527.1| 76|Anopheles gambiae gSG9 protein protein. 23 7.4 >AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.4 bits (48), Expect = 4.2 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = -3 Query: 288 EWTTYTNHFQQ------LVEKRLHKHNXICVEDLIHEIFTVGEKFKYA 163 +W Y N F L +RLH+ + +L+ E+ K+KYA Sbjct: 191 DWVAYRNGFGSVDGEFWLGLERLHRITAAQIHELLVELKDFSGKYKYA 238 >AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.4 bits (48), Expect = 4.2 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = -3 Query: 288 EWTTYTNHFQQ------LVEKRLHKHNXICVEDLIHEIFTVGEKFKYA 163 +W Y N F L +RLH+ + +L+ E+ K+KYA Sbjct: 191 DWVAYRNGFGSVDGEFWLGLERLHRITAAQIHELLVELKDFSGKYKYA 238 >AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 23.4 bits (48), Expect = 4.2 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = -3 Query: 288 EWTTYTNHFQQ------LVEKRLHKHNXICVEDLIHEIFTVGEKFKYA 163 +W Y N F L +RLH+ + +L+ E+ K+KYA Sbjct: 191 DWVAYRNGFGSVDGEFWLGLERLHRITAAQIHELLVELKDFSGKYKYA 238 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 288 EWTTYTNHFQQLVEKRLHK 232 +W T + H Q L KRLHK Sbjct: 551 KWPTKSVHEQALFWKRLHK 569 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 5.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 103 GLLAPTTSWIVQFEGPQEITRVLELFSNSEDLMDEVLN 216 GLLAPTTS + E ++ V+ S + +DE+++ Sbjct: 2 GLLAPTTSCDGEEELQVQLRSVIITRSKAGATVDEIID 39 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 5.6 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = -3 Query: 180 EKFKYASNFLWPFKLNNPTGGWRKKTIH 97 E+F + ++ +P + G W K ++H Sbjct: 14 EQFHFLNDLKYPVLIRQHLGNWIKDSLH 41 >AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.6 bits (46), Expect = 7.4 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = -3 Query: 288 EWTTYTNHFQQ------LVEKRLHKHNXICVEDLIHEIFTVGEKFKYA 163 +W Y N F L +R+H+ + +L+ E+ K+KYA Sbjct: 191 DWVAYRNGFGSVDGEFWLGLERIHRITAAQIHELLVELKDFSGKYKYA 238 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 22.6 bits (46), Expect = 7.4 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -3 Query: 399 IRLL*ICYGIAEPYIAWGYPNLKSV 325 + L C + P +A+GYP+L+++ Sbjct: 37 LAFLSFCLLVVIPKVAFGYPDLETM 61 >AJ302662-1|CAC35527.1| 76|Anopheles gambiae gSG9 protein protein. Length = 76 Score = 22.6 bits (46), Expect = 7.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +1 Query: 1 FFYNYKSIYLNHPXEKIVDLVFAVTKVSPVDIMNG 105 FF+ Y YL+ P ++ V + S V + G Sbjct: 26 FFFQYNRPYLSQPSSQLASTAANVVQRSNVTVALG 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,572 Number of Sequences: 2352 Number of extensions: 10005 Number of successful extensions: 21 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -