BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0612.Seq (485 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical ... 28 4.1 Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 27 5.5 Z81143-5|CAB03518.2| 370|Caenorhabditis elegans Hypothetical pr... 27 7.2 AC006675-6|AAK84556.2| 433|Caenorhabditis elegans Nuclear hormo... 27 7.2 U00066-3|AAA50740.1| 177|Caenorhabditis elegans Hypothetical pr... 27 9.5 >AF077545-1|AAC26306.2| 506|Caenorhabditis elegans Hypothetical protein H41C03.3 protein. Length = 506 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 354 CSXNVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 473 C NV + P DSA H N +N I WNY Sbjct: 211 CLPNVLLLPDEESVDSAGHNINLAHYNCLRVLINKPGWNY 250 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 27.5 bits (58), Expect = 5.5 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 Query: 441 CCG*KARSCICAPRCRC 391 CCG C C PRC C Sbjct: 79 CCGCGCGCCCCRPRCCC 95 >Z81143-5|CAB03518.2| 370|Caenorhabditis elegans Hypothetical protein ZK265.7 protein. Length = 370 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 287 EEHRDRILILNRRFLERRLTDDMLRKRV 370 EE R+R + RR ERRL +D + +R+ Sbjct: 294 EEERERYRMERRRAEERRLQEDTILRRI 321 >AC006675-6|AAK84556.2| 433|Caenorhabditis elegans Nuclear hormone receptor familyprotein 98 protein. Length = 433 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 86 LDRRKTNISESICQRCFHQSRTKVRGS 6 L+ +S ICQ CFHQ K++G+ Sbjct: 331 LEPTHEELSYMICQLCFHQVGKKLQGN 357 >U00066-3|AAA50740.1| 177|Caenorhabditis elegans Hypothetical protein R12B2.2 protein. Length = 177 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 310 DIEPAFFRTPAHRRYAPXTCQY 375 D++P F R+P R P T +Y Sbjct: 137 DLQPLFHRSPCEERVRPITAKY 158 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,166,847 Number of Sequences: 27780 Number of extensions: 203779 Number of successful extensions: 510 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -