Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0610.Seq
         (489 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q1PLG5 Cluster: Putative uncharacterized protein; n=2; ...    36   0.37 

>UniRef50_Q1PLG5 Cluster: Putative uncharacterized protein; n=2;
           Clostridium perfringens|Rep: Putative uncharacterized
           protein - Clostridium perfringens
          Length = 133

 Score = 36.3 bits (80), Expect = 0.37
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = -2

Query: 335 LLLQDVCE---DGVQS*HIVTMVSDC*IRGLIATGFISFLKLSNTYKWFEKPSKAAVQFI 165
           +L+ DV E   D   S H+ ++V DC I  L   G+I F+K +++ KW  K  K  + FI
Sbjct: 57  ILVSDVYENFYDNKTSNHVPSVVDDC-INNLNKMGYIKFIKTNSSPKWMVKIEK-NLDFI 114

Query: 164 VPDGPKCLY 138
           + DG +  Y
Sbjct: 115 L-DGEEDFY 122


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 536,646,062
Number of Sequences: 1657284
Number of extensions: 10978465
Number of successful extensions: 23995
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 23333
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23994
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 28019067077
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)