BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0610.Seq (489 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_7350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_55308| Best HMM Match : Keratin_B2 (HMM E-Value=2.2) 27 8.3 >SB_18192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 379 TDFTKQACVPWMGRHYYYKMSAKTECKADTLLPWFPIVE 263 T + + CV MG HY+Y +S +C D LP F +V+ Sbjct: 178 TPWVEGECVRAMGVHYHYNISKTFDC--DYALPVFLLVD 214 >SB_7350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 379 TDFTKQACVPWMGRHYYYKMSAKTECKADTLLPWFPIVE 263 T + + CV MG HY+Y +S +C D LP F +V+ Sbjct: 61 TPWVEGECVRAMGVHYHYNISKTFDC--DYALPVFLLVD 97 >SB_55308| Best HMM Match : Keratin_B2 (HMM E-Value=2.2) Length = 227 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 144 ALRAIRNNELNSCFRRLLKPFVSVRKFQEANKTGSDQSPDSTI 272 A R I N+ ++CF L+ K +E + +DQ+P STI Sbjct: 93 AKRTISNSSDDNCFHLELEDKCEDIKKEETPQQTNDQTPQSTI 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,647,296 Number of Sequences: 59808 Number of extensions: 360269 Number of successful extensions: 849 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -