BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0608.Seq (488 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 23 1.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.9 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 23.0 bits (47), Expect = 1.5 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 Query: 348 VLISSPAAATPMITDTPHPLWQASSAALMVPTFPIHSKVYSRPPSVN 488 V++ A +TP I W S + P F I + +YS VN Sbjct: 269 VIVMYIACSTPFILAQLWATWDPQSPFIDGPVFVILTLLYSLNSCVN 315 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +1 Query: 124 LRNYMSTTARIDFPACIKWNASLISFSGTL 213 +RN M F + W + FSGT+ Sbjct: 409 IRNKMKWIKDNGFAGAMVWTIDMDDFSGTV 438 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,153 Number of Sequences: 336 Number of extensions: 3061 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -