BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0604.Seq (476 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC034502-1|AAH34502.1| 594|Homo sapiens choline dehydrogenase p... 55 1e-07 AJ272267-1|CAB75961.1| 482|Homo sapiens choline dehydrogenase p... 55 1e-07 AL137689-1|CAB70875.1| 420|Homo sapiens hypothetical protein pr... 29 8.3 >BC034502-1|AAH34502.1| 594|Homo sapiens choline dehydrogenase protein. Length = 594 Score = 55.2 bits (127), Expect = 1e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 217 VVDPQLKVYGIGGLRVIDASVMPSQPTGNPQAAIMMVAERGAAFIK 80 VVDPQ +V G+ LRV+DAS+MPS +GN A +M+AE+ A IK Sbjct: 527 VVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIK 572 >AJ272267-1|CAB75961.1| 482|Homo sapiens choline dehydrogenase protein. Length = 482 Score = 55.2 bits (127), Expect = 1e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 217 VVDPQLKVYGIGGLRVIDASVMPSQPTGNPQAAIMMVAERGAAFIK 80 VVDPQ +V G+ LRV+DAS+MPS +GN A +M+AE+ A IK Sbjct: 415 VVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIK 460 >AL137689-1|CAB70875.1| 420|Homo sapiens hypothetical protein protein. Length = 420 Score = 29.1 bits (62), Expect = 8.3 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -1 Query: 248 SSTRHNRYRLGRRSSTKSLRNWRFESYRCIGHAVTADGQSPSSDHDGRRARRG 90 SS R R RRSS+++++ R ES++ H + P GRR + G Sbjct: 120 SSQRMRRSGRTRRSSSRTMKR-RLESFKSTKHNICFTKSKPRPRKTGRRKKDG 171 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,580,553 Number of Sequences: 237096 Number of extensions: 1314504 Number of successful extensions: 3020 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3016 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -