BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0602.Seq (473 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 28 0.050 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 0.62 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 27.9 bits (59), Expect = 0.050 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -2 Query: 193 FGSQPMHRRR*RIYYWSSVHCTPRLYRNSCVPSHCSLTDSYPYRSKI-QLLYFQIHDFSC 17 FG+ ++ R YYW +++ T + SC + + + P++ + +LY I D C Sbjct: 143 FGATKVYNSMKREYYWPNMYRTIKKRLRSCDLCQKTKSSNRPHQGPLTPILYDHIGDLVC 202 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 0.62 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +1 Query: 70 DKNRSVNSGSERKSSGKDEEYSEQNSSNK-SFNDGDASADYQTKSKKVE 213 D+ RS + +E KSS D SE+ S S N + AD+ KVE Sbjct: 29 DEKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHSPVFGKVE 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.126 0.328 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,910 Number of Sequences: 336 Number of extensions: 1219 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits)
- SilkBase 1999-2023 -