BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0600.Seq (459 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL611964-2|CAH73872.1| 495|Homo sapiens REST corepressor 3 prot... 30 3.3 AL590101-2|CAH72433.1| 495|Homo sapiens REST corepressor 3 prot... 30 3.3 AK001738-1|BAA91872.1| 495|Homo sapiens protein ( Homo sapiens ... 30 3.3 AF143946-1|AAD39760.1| 2971|Homo sapiens transcriptional activat... 30 3.3 AB037764-1|BAA92581.1| 520|Homo sapiens KIAA1343 protein protein. 30 3.3 X76091-1|CAA53705.1| 723|Homo sapiens DNA binding protein RFX2 ... 30 4.4 D21163-1|BAA04699.2| 977|Homo sapiens KIAA0031 protein. 30 4.4 BC071571-1|AAH71571.1| 723|Homo sapiens RFX2 protein protein. 30 4.4 BC028579-1|AAH28579.1| 723|Homo sapiens regulatory factor X, 2 ... 30 4.4 AJ505017-1|CAD43720.1| 850|Homo sapiens small nuclear ribonucle... 30 4.4 AL132655-8|CAM28316.1| 625|Homo sapiens GNAS complex locus prot... 29 5.8 AK128030-1|BAC87237.1| 2427|Homo sapiens protein ( Homo sapiens ... 29 5.8 AK126463-1|BAC86558.1| 559|Homo sapiens protein ( Homo sapiens ... 29 5.8 AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein. 29 5.8 CR456774-1|CAG33055.1| 972|Homo sapiens U5-116KD protein. 29 7.7 BC002360-1|AAH02360.1| 972|Homo sapiens elongation factor Tu GT... 29 7.7 >AL611964-2|CAH73872.1| 495|Homo sapiens REST corepressor 3 protein. Length = 495 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLR 330 AP+ P P A Q PL LP A +HR PPL+ Sbjct: 397 APSSTPTPTAPIATLNQPPPLLRPTLPAAPALHRQPPPLQ 436 >AL590101-2|CAH72433.1| 495|Homo sapiens REST corepressor 3 protein. Length = 495 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLR 330 AP+ P P A Q PL LP A +HR PPL+ Sbjct: 397 APSSTPTPTAPIATLNQPPPLLRPTLPAAPALHRQPPPLQ 436 >AK001738-1|BAA91872.1| 495|Homo sapiens protein ( Homo sapiens cDNA FLJ10876 fis, clone NT2RP4001838, weakly similar to Homo sapiens CoREST protein mRNA. ). Length = 495 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLR 330 AP+ P P A Q PL LP A +HR PPL+ Sbjct: 397 APSSTPTPTAPIATLNQPPPLLRPTLPAAPALHRQPPPLQ 436 >AF143946-1|AAD39760.1| 2971|Homo sapiens transcriptional activator SRCAP protein. Length = 2971 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVL 375 AP VPAAP PP +P A P + L Sbjct: 1222 APVVPAAPGPPSLQPSGASPSASAL 1246 >AB037764-1|BAA92581.1| 520|Homo sapiens KIAA1343 protein protein. Length = 520 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLR 330 AP+ P P A Q PL LP A +HR PPL+ Sbjct: 422 APSSTPTPTAPIATLNQPPPLLRPTLPAAPALHRQPPPLQ 461 >X76091-1|CAA53705.1| 723|Homo sapiens DNA binding protein RFX2 protein. Length = 723 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQP----LQAVLLPRAVQVHRTLPPLRLVFPGVI 309 AP VPA+P + + P +Q + LPR QV + + P++ V+P + Sbjct: 22 APPVPASPQRVLVQAASSNPKGSQMQPISLPRVQQVPQQVQPVQHVYPAQV 72 >D21163-1|BAA04699.2| 977|Homo sapiens KIAA0031 protein. Length = 977 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 315 SHHSGVNRLLHKPGQGKICLSSKTYSIFLTISVRISVFNTTKHDLEY 175 S +S L+ P G +C SS YSI T+ ++ T D+ Y Sbjct: 295 SMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINY 341 >BC071571-1|AAH71571.1| 723|Homo sapiens RFX2 protein protein. Length = 723 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQP----LQAVLLPRAVQVHRTLPPLRLVFPGVI 309 AP VPA+P + + P +Q + LPR QV + + P++ V+P + Sbjct: 22 APPVPASPQRVLVQAASSNPKGAQMQPISLPRVQQVPQQVQPVQHVYPAQV 72 >BC028579-1|AAH28579.1| 723|Homo sapiens regulatory factor X, 2 (influences HLA class II expression) protein. Length = 723 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQP----LQAVLLPRAVQVHRTLPPLRLVFPGVI 309 AP VPA+P + + P +Q + LPR QV + + P++ V+P + Sbjct: 22 APPVPASPQRVLVQAASSNPKGAQMQPISLPRVQQVPQQVQPVQHVYPAQV 72 >AJ505017-1|CAD43720.1| 850|Homo sapiens small nuclear ribonucleoprotein component protein. Length = 850 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 315 SHHSGVNRLLHKPGQGKICLSSKTYSIFLTISVRISVFNTTKHDLEY 175 S +S L+ P G +C SS YSI T+ ++ T D+ Y Sbjct: 168 SMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINY 214 >AL132655-8|CAM28316.1| 625|Homo sapiens GNAS complex locus protein. Length = 625 Score = 29.5 bits (63), Expect = 5.8 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 7/49 (14%) Frame = -2 Query: 440 VPAAPIPPQARPGQAQPLQAV---LLPRAVQVH----RTLPPLRLVFPG 315 +P PIP RP QP+ L P+ +Q+ R PPLRL+ PG Sbjct: 372 LPPQPIPTPGRPLTPQPIPTPGRPLTPQPIQMPGRPLRLPPPLRLLRPG 420 >AK128030-1|BAC87237.1| 2427|Homo sapiens protein ( Homo sapiens cDNA FLJ46149 fis, clone TESTI4000621, moderately similar to Homo sapiens Snf2-related CBP activator protein (SRCAP). ). Length = 2427 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVL 375 AP VPAAP PP P A P + L Sbjct: 1481 APVVPAAPGPPSLAPSGASPSASAL 1505 >AK126463-1|BAC86558.1| 559|Homo sapiens protein ( Homo sapiens cDNA FLJ44499 fis, clone UTERU3000665, highly similar to Homo sapiens Snf2-related CBP activator protein (SRCAP). ). Length = 559 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVL 375 AP VPAAP PP P A P + L Sbjct: 130 APVVPAAPGPPSLAPSGASPSASAL 154 >AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein. Length = 3053 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 449 APTVPAAPIPPQARPGQAQPLQAVL 375 AP VPAAP PP P A P + L Sbjct: 1304 APVVPAAPGPPSLAPSGASPSASAL 1328 >CR456774-1|CAG33055.1| 972|Homo sapiens U5-116KD protein. Length = 972 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 315 SHHSGVNRLLHKPGQGKICLSSKTYSIFLTISVRISVFNTTKHDLEY 175 S +S L+ P G +C SS YSI T+ ++ T D+ Y Sbjct: 290 SMYSTDENLILSPLLGNVCFSSSQYSICFTLVSFAKIYADTFGDINY 336 >BC002360-1|AAH02360.1| 972|Homo sapiens elongation factor Tu GTP binding domain containing 2 protein. Length = 972 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 315 SHHSGVNRLLHKPGQGKICLSSKTYSIFLTISVRISVFNTTKHDLEY 175 S +S L+ P G +C SS YSI T+ ++ T D+ Y Sbjct: 290 SMYSTDENLILSPLLGNVCFSSSQYSICFTLVSFAKIYADTFGDINY 336 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,327,225 Number of Sequences: 237096 Number of extensions: 1238897 Number of successful extensions: 3818 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3802 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3872123864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -