BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0599.Seq (399 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 25 0.21 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 0.36 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 4.5 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 20 7.8 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 25.4 bits (53), Expect = 0.21 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 LP+GT +G+G F + PNP Sbjct: 82 LPVGTTVGIGQFLVHRNPKYFPNP 105 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 24.6 bits (51), Expect = 0.36 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -2 Query: 263 KKLLDCIQLTLSAHLEKT---YTAKQERMGLVHR 171 KK L C+ TLS +LE+T ++ + R+ L HR Sbjct: 222 KKPLLCVVSTLSCYLERTELLRSSGETRLFLTHR 255 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 66 DYLSTFVLERNIIDT 22 D+L+TF+ E+NI T Sbjct: 423 DFLATFLSEQNIQST 437 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.2 bits (40), Expect = 7.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 181 WFTGSRRCWTLLIPVGIRIIHS 116 W S TLL+ +G RII S Sbjct: 461 WVPASDNLPTLLLELGYRIIVS 482 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,120 Number of Sequences: 336 Number of extensions: 1514 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -