BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0599.Seq (399 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0462 + 5976706-5976816,5976845-5976988 29 1.8 06_02_0337 - 14638429-14639295,14640281-14640460,14640743-14641831 27 4.1 06_01_0375 + 2699179-2699264,2699697-2699786,2699913-2699991,270... 26 9.5 >04_01_0462 + 5976706-5976816,5976845-5976988 Length = 84 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -2 Query: 254 LDCIQLTLSAHLEKTYTAKQERMGLVHRVQEVLDSVD 144 LD + + SAHLE T TAK E + ++ ++L+ +D Sbjct: 41 LDLLAMITSAHLEPTLTAK-EFLRAINEQSKMLEEID 76 >06_02_0337 - 14638429-14639295,14640281-14640460,14640743-14641831 Length = 711 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 381 LLPMSPLXMAKSWVWFQMSLLNSC-KCAQT 295 L P S L AK W + + +N+C KC+ T Sbjct: 81 LFPFSLLKRAKQWFYANRAAINTCDKCSTT 110 >06_01_0375 + 2699179-2699264,2699697-2699786,2699913-2699991, 2700816-2700893,2701290-2701338,2702183-2702232, 2702704-2702853,2703437-2703517,2703593-2703609, 2705804-2705893,2706033-2706111,2706234-2706311, 2707554-2707687,2707858-2707936,2708108-2708188, 2708263-2708400 Length = 452 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 293 NTVPRGRHLWKKLLDCIQLTLSAHLEKTYTAKQERMG 183 N +P+G H W KL+ +L L LE+ + QE G Sbjct: 193 NWLPKGTHQWSKLVTPEELVLI--LERASISVQEMAG 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,793,388 Number of Sequences: 37544 Number of extensions: 149900 Number of successful extensions: 298 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -