BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0599.Seq (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding pr... 24 2.4 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 5.4 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 22 7.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 22 7.2 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 22 7.2 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 22 7.2 >AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding protein AgamOBP15 protein. Length = 147 Score = 23.8 bits (49), Expect = 2.4 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 197 ASPYKFSQDELKVLAECNQ 253 A P +F+ LKVLA+CN+ Sbjct: 93 AIPKQFNSIALKVLAKCNK 111 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 386 PXYCQCXLWXWPNL 345 P C LW WP+L Sbjct: 84 PHVICCRLWRWPDL 97 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 119 IPAGTTVVIGTYKIHRREDLYPHP 142 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 119 IPAGTTVVIGTYKIHRREDLYPHP 142 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 119 IPAGTTVVIGTYKIHRREDLYPHP 142 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 119 IPAGTTVVIGTYKIHRREDLYPHP 142 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 122 IPAGTTVVIGTYKIHRREDLYPHP 145 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 122 IPAGTTVVIGTYKIHRREDLYPHP 145 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 133 IPAGTTVVIGTYKIHRREDLYPHP 156 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 133 IPAGTTVVIGTYKIHRREDLYPHP 156 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 119 IPAGTTVVIGTYKIHRREDLYPHP 142 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 119 IPAGTTVVIGTYKIHRREDLYPHP 142 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 133 IPAGTTVVIGTYKIHRREDLYPHP 156 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 133 IPAGTTVVIGTYKIHRREDLYPHP 156 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 133 IPAGTTVVIGTYKIHRREDLYPHP 156 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 133 IPAGTTVVIGTYKIHRREDLYPHP 156 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 118 IPAGTTVVIGTYKIHRREDLYPHP 141 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 118 IPAGTTVVIGTYKIHRREDLYPHP 141 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 131 IPAGTTVVIGTYKIHRREDLYPHP 154 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 132 IPAGTTVVIGTYKIHRREDLYPHP 155 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 132 IPAGTTVVIGTYKIHRREDLYPHP 155 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 130 IPAGTTVVIGTYKIHRREDLYPHP 153 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.2 bits (45), Expect = 7.2 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = -2 Query: 233 LSAHLEKTYTAKQERMGLVHRVQEVLDSVDTRRHSNYS*FKYLMTKLKN 87 L++HL++ + + + VH V+ + + H + F Y T N Sbjct: 1744 LTSHLKEYFAFYENFITQVHGTSHVMSGMVAKAHPSCEGFPYSRTIYAN 1792 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 22.2 bits (45), Expect = 7.2 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -2 Query: 386 PXYCQCXLWXWPNL 345 P C +W WP+L Sbjct: 98 PHVIYCRVWRWPDL 111 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 274 LPLGTVLGLGTFAAIQKGHLKPNP 345 +P GT + +GT+ ++ L P+P Sbjct: 94 IPAGTTVVIGTYKIHRREDLYPHP 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 360,069 Number of Sequences: 2352 Number of extensions: 6563 Number of successful extensions: 58 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -