BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0597.Seq (469 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0292 - 16436918-16439233 30 0.81 >09_04_0292 - 16436918-16439233 Length = 771 Score = 30.3 bits (65), Expect = 0.81 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 228 LHLKIYIPFNIK*ICYVVQYINLKQLLLKTNLYSNTXRKTG*IRAN 365 L+ K + N+K +++ +++ +L+L+ N Y T R G IR N Sbjct: 136 LYYKAQLRMNLKVPLFILWSLSVARLVLRINAYRTTSRDNGLIREN 181 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,346,146 Number of Sequences: 37544 Number of extensions: 135078 Number of successful extensions: 155 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -