Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0597.Seq
         (469 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0292 - 16436918-16439233                                         30   0.81 

>09_04_0292 - 16436918-16439233
          Length = 771

 Score = 30.3 bits (65), Expect = 0.81
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = +3

Query: 228 LHLKIYIPFNIK*ICYVVQYINLKQLLLKTNLYSNTXRKTG*IRAN 365
           L+ K  +  N+K   +++  +++ +L+L+ N Y  T R  G IR N
Sbjct: 136 LYYKAQLRMNLKVPLFILWSLSVARLVLRINAYRTTSRDNGLIREN 181


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,346,146
Number of Sequences: 37544
Number of extensions: 135078
Number of successful extensions: 155
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 155
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 943260316
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)