BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0595.Seq (489 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M96388-1|AAA28662.1| 3712|Drosophila melanogaster laminin A chai... 28 7.9 M75882-1|AAA28661.1| 1951|Drosophila melanogaster laminin A chai... 28 7.9 L07288-1|AAC37178.1| 3712|Drosophila melanogaster laminin A prot... 28 7.9 AE014296-1101|AAF50672.2| 3712|Drosophila melanogaster CG10236-P... 28 7.9 >M96388-1|AAA28662.1| 3712|Drosophila melanogaster laminin A chain protein. Length = 3712 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 66 CQYCSYTSWGYNSDGCCKCRXDSKILCR*IEC---TGRCR 176 C C+ W Y DGC C + R C TG+C+ Sbjct: 2046 CDRCAVDHWKYEKDGCTPCNCNQG-YSRGFGCNPNTGKCQ 2084 >M75882-1|AAA28661.1| 1951|Drosophila melanogaster laminin A chain protein. Length = 1951 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 66 CQYCSYTSWGYNSDGCCKCRXDSKILCR*IEC---TGRCR 176 C C+ W Y DGC C + R C TG+C+ Sbjct: 285 CDRCAVDHWKYEKDGCTPCNCNQG-YSRGFGCNPNTGKCQ 323 >L07288-1|AAC37178.1| 3712|Drosophila melanogaster laminin A protein. Length = 3712 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 66 CQYCSYTSWGYNSDGCCKCRXDSKILCR*IEC---TGRCR 176 C C+ W Y DGC C + R C TG+C+ Sbjct: 2046 CDRCAVDHWKYEKDGCTPCNCNQG-YSRGFGCNPNTGKCQ 2084 >AE014296-1101|AAF50672.2| 3712|Drosophila melanogaster CG10236-PA protein. Length = 3712 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 66 CQYCSYTSWGYNSDGCCKCRXDSKILCR*IEC---TGRCR 176 C C+ W Y DGC C + R C TG+C+ Sbjct: 2046 CDRCAVDHWKYEKDGCTPCNCNQG-YSRGFGCNPNTGKCQ 2084 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,823,362 Number of Sequences: 53049 Number of extensions: 163578 Number of successful extensions: 857 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 857 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1726192251 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -