BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0593.Seq (279 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022971-13|AAG23979.1| 325|Caenorhabditis elegans Serpentine r... 28 0.86 U80028-2|AAN73869.1| 351|Caenorhabditis elegans Serpentine rece... 26 3.5 >AF022971-13|AAG23979.1| 325|Caenorhabditis elegans Serpentine receptor, class h protein247 protein. Length = 325 Score = 28.3 bits (60), Expect = 0.86 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 10 YVYYLGNTITFFFFPVQNRGFXCMLIKVKQR 102 ++ + N ITFF PV G C+L K +R Sbjct: 15 FLISISNVITFFEIPVCTFGAYCILFKTPER 45 >U80028-2|AAN73869.1| 351|Caenorhabditis elegans Serpentine receptor, class h protein88 protein. Length = 351 Score = 26.2 bits (55), Expect = 3.5 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 13 VYYLGNTITFFFFPVQNRGFXCMLIK-VKQRESYR 114 V Y + +T F FPV G C+L K K+ SYR Sbjct: 28 VSYTSHFLTAFSFPVYLFGGYCILYKSPKEMSSYR 62 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,784,709 Number of Sequences: 27780 Number of extensions: 60649 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 12,740,198 effective HSP length: 69 effective length of database: 10,823,378 effective search space used: 248937694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -