BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0591.Seq (489 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.09c |||CAF1 family ribonuclease|Schizosaccharomyces po... 25 8.1 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 25 8.1 >SPBC29A10.09c |||CAF1 family ribonuclease|Schizosaccharomyces pombe|chr 2|||Manual Length = 427 Score = 24.6 bits (51), Expect = 8.1 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 335 LFIY*VAPTK*SSIQNIDKLTKVHGR-CHLNYRCN 436 LF+Y V TK S IQ + +HG LN C+ Sbjct: 393 LFVYYVMRTKHSDIQRWQNVLPIHGSFLDLNKYCS 427 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 24.6 bits (51), Expect = 8.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 184 ISSQTHKCETINLFISFVKRLIHVVDSRQ 98 +SS +K +T L R +H++D+RQ Sbjct: 141 VSSVCYKKDTPLLLTGSTSRSVHIIDTRQ 169 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,807,844 Number of Sequences: 5004 Number of extensions: 33708 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 190087364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -