BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0591.Seq (489 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 26 0.25 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 5.3 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.8 bits (54), Expect = 0.25 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 343 LLSCTNKVIINTKH*QIDKSSWQMS 417 +L NKVII+ K+ I+K WQ++ Sbjct: 232 VLHSINKVIIHPKYDIIEKDDWQIN 256 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 5.3 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 Query: 233 IVTIKSEHFYHLSTRLNFESNS*M*DNKFIYFFCKETNPCC 111 I+T S FY+LST +N + M NKF F CC Sbjct: 328 ILTYMSGVFYYLSTTVNPLLYNIM-SNKFREAFKLMLPNCC 367 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,951 Number of Sequences: 438 Number of extensions: 2368 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -