BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0585.Seq (492 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59520.1 68416.m06642 rhomboid family protein contains Pfam p... 32 0.18 At4g14970.1 68417.m02301 hypothetical protein 31 0.42 At1g11480.1 68414.m01319 eukaryotic translation initiation facto... 30 0.74 At1g06960.2 68414.m00741 small nuclear ribonucleoprotein U2B, pu... 29 1.3 At1g06960.1 68414.m00740 small nuclear ribonucleoprotein U2B, pu... 29 1.3 At5g03490.1 68418.m00305 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.2 At3g30550.1 68416.m03866 hypothetical protein includes At2g05890... 29 2.2 At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, pu... 29 2.2 At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-conta... 29 2.2 At4g14280.1 68417.m02201 hypothetical protein 28 3.0 At4g02580.1 68417.m00352 NADH-ubiquinone oxidoreductase 24 kDa s... 28 3.0 At1g03230.1 68414.m00301 extracellular dermal glycoprotein, puta... 28 3.0 At2g30670.1 68415.m03740 tropinone reductase, putative / tropine... 28 3.9 At1g76090.1 68414.m08836 S-adenosyl-methionine-sterol-C-methyltr... 27 5.2 At4g35210.1 68417.m05004 hypothetical protein contains Pfam prof... 27 6.9 At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1)... 27 6.9 At1g67460.1 68414.m07681 hypothetical protein contains Pfam doma... 27 9.1 >At3g59520.1 68416.m06642 rhomboid family protein contains Pfam profile PF01694: Rhomboid family Length = 269 Score = 32.3 bits (70), Expect = 0.18 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -2 Query: 392 LSLSTALSPFEILSFTELVIPHVPAFFGHL 303 LSL + +PFE L FT +++P +F GHL Sbjct: 158 LSLPISFAPFESLIFTSIIVPQA-SFLGHL 186 >At4g14970.1 68417.m02301 hypothetical protein Length = 1286 Score = 31.1 bits (67), Expect = 0.42 Identities = 21/81 (25%), Positives = 35/81 (43%) Frame = +1 Query: 55 SEVNEKMKREDLKDALTKLGAEVAYIDFKSGDTEGWVRLSKENAAKEMVEKIEDGKIKIC 234 S+VNEK+++ + DA K GA +++ + T + AA M E D + I Sbjct: 718 SDVNEKLRQPTIMDAFKKAGAVMSHSQTQLRGTPSLPSMDGSTAAGSMDENCSDNESLIV 777 Query: 235 DSEVIFNCLKVTMRKRISLKP 297 + + L+ K L P Sbjct: 778 KIPQVSSALEAQRFKFRPLLP 798 >At1g11480.1 68414.m01319 eukaryotic translation initiation factor-related contains weak similarity to Swiss-Prot:P23588 eukaryotic translation initiation factor 4B (eIF-4B) [Homo sapiens] Length = 578 Score = 30.3 bits (65), Expect = 0.74 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +1 Query: 280 RISLKPWKR*PKNAGT*GITSSVKERISKGDKAVERESPKIMKRHLQRKSKRSNQN 447 R+ LKP +R P++A ++S R K D+ R I + QR++ R N+N Sbjct: 426 RMVLKPIERVPEHASQRPVSSPRDMRTRKFDQKDGRNVSDIARSETQRRNWRENEN 481 >At1g06960.2 68414.m00741 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative non-consensus splice donor GC at exon 4; similar to spliceosomal protein (U2B) GI:169588 from [Solanum tuberosum] Length = 228 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +1 Query: 28 LPTGSVFHFSEVNEKMKREDLKDAL----TKLGAEVAYIDFKSGDTEG--WVRLSKENAA 189 +P + +NEK+K+E+LK +L ++ G + + K+ G WV ++ AA Sbjct: 6 IPPNQSIYIKHINEKIKKEELKRSLYCLFSQFGRLLDVVALKTPKLRGQAWVVFTEVTAA 65 Query: 190 KEMVEKIED 216 V ++++ Sbjct: 66 SNAVRQMQN 74 >At1g06960.1 68414.m00740 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative non-consensus splice donor GC at exon 4; similar to spliceosomal protein (U2B) GI:169588 from [Solanum tuberosum] Length = 229 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +1 Query: 28 LPTGSVFHFSEVNEKMKREDLKDAL----TKLGAEVAYIDFKSGDTEG--WVRLSKENAA 189 +P + +NEK+K+E+LK +L ++ G + + K+ G WV ++ AA Sbjct: 6 IPPNQSIYIKHINEKIKKEELKRSLYCLFSQFGRLLDVVALKTPKLRGQAWVVFTEVTAA 65 Query: 190 KEMVEKIED 216 V ++++ Sbjct: 66 SNAVRQMQN 74 >At5g03490.1 68418.m00305 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 465 Score = 28.7 bits (61), Expect = 2.2 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = -2 Query: 320 AFFGHLFHGFSEIRFLIVTFKQLKMTSESHILIFP-SSIFSTISLAAFSLDSLTQPSVSP 144 AFF F S ++F +K T H+L P + IF L + SL P SP Sbjct: 149 AFFSISFFLVSVLQFCFENIDLIKSTDPIHLLDLPRAPIFKEEHLPSIVRRSLQTP--SP 206 Query: 143 DLKSM 129 DL+S+ Sbjct: 207 DLESI 211 >At3g30550.1 68416.m03866 hypothetical protein includes At2g05890, At4g07450, At3g30630, At3g43100, At2g09960, At3g30550, At1g39430, At2g10460, At4g03640, At5g35250 Length = 509 Score = 28.7 bits (61), Expect = 2.2 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 7/82 (8%) Frame = -2 Query: 362 EILSFTELVIPHVPAFFGHLFHGF--SEIRFLIVTFKQLKMTSESHILIFPSSIFSTISL 189 E + F ++ +P P F+ + +GF S + + + T E+ ++F S + + Sbjct: 312 EAIKFEDVKLPQKPRFWCEICNGFAKSVVPKFWLHLHIMDQTGEAKCMLFDSHAKEILGI 371 Query: 188 AAF-----SLDSLTQPSVSPDL 138 A S D + P+V PD+ Sbjct: 372 TAHDLLAGSFDEIEDPTVLPDV 393 >At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative similar to spliceosomal protein [Solanum tuberosum] GI:169589 Length = 232 Score = 28.7 bits (61), Expect = 2.2 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +1 Query: 28 LPTGSVFHFSEVNEKMKREDLKDAL----TKLGAEVAYIDFKSGDTEG--WVRLSKENAA 189 +P + +NE++K+E+LK +L ++ G + + K+ G WV S+ AA Sbjct: 6 IPPNQSIYIQNLNERIKKEELKRSLYCLFSQFGRILDVVALKTPKLRGQAWVTFSEVTAA 65 Query: 190 KEMVEKIED 216 V ++++ Sbjct: 66 GHAVRQMQN 74 >At2g26890.1 68415.m03226 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226: DnaJ domain Length = 2554 Score = 28.7 bits (61), Expect = 2.2 Identities = 22/105 (20%), Positives = 49/105 (46%), Gaps = 4/105 (3%) Frame = +1 Query: 1 QQQEKEELKLPTGSVFHFSEVN-EKMKREDL-KDALTKLGAEVAYID--FKSGDTEGWVR 168 ++ ++ + L G E++ + +DL + A +L E++ I ++ D E R Sbjct: 1486 EELTRKPMDLSEGEACKILEISLNNVSSDDLNRTASVELNEEISNISKQIQNLDEEKLKR 1545 Query: 169 LSKENAAKEMVEKIEDGKIKICDSEVIFNCLKVTMRKRISLKPWK 303 ++ A + +K +G+ K + + CL+ TM+ +PW+ Sbjct: 1546 QYRKLAMRYHPDKNPEGREKFLAVQKAYECLQATMQGLQGPQPWR 1590 >At4g14280.1 68417.m02201 hypothetical protein Length = 798 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 34 TGSVFHFSEVNEKMKREDLKDALTKLGAEV-AYIDFKSGDTE 156 +G VF S + E + + L KLGAE+ ++ F+ G TE Sbjct: 515 SGIVFTVSNIRETLHHGKSQPHLQKLGAEILTFLAFEEGATE 556 >At4g02580.1 68417.m00352 NADH-ubiquinone oxidoreductase 24 kDa subunit, putative similar to NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) (Polypeptide II) (Swiss-Prot:P04394) [Bos taurus] Length = 255 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/76 (25%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Frame = +1 Query: 46 FHFSEVNEKMKREDLK--DALTKLGAEVAYIDFKSGDTEGWVRLSKENAAKEMVEKIEDG 219 + FSE N+ +E L + K A + +D GW+ +S NA +++E Sbjct: 47 WEFSEANQSKVKEILSYYPSNYKQSAVIPLLDLAQQQNGGWLPVSAMNAVAKVIEVAPIR 106 Query: 220 KIKICDSEVIFNCLKV 267 ++ +FN KV Sbjct: 107 VYEVATFYSMFNRAKV 122 >At1g03230.1 68414.m00301 extracellular dermal glycoprotein, putative / EDGP, putative similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 434 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 209 IFSTISLAAFSLDSLTQPSVSPDLKSMYATSAPNLVR 99 IFS + L+ FSL S QPS P + T P+ ++ Sbjct: 8 IFSVLLLSIFSLSSSAQPSFRPKALLLPVTKDPSTLQ 44 >At2g30670.1 68415.m03740 tropinone reductase, putative / tropine dehydrogenase, putative similar to tropinone reductase SP:P50165 from [Datura stramonium] Length = 262 Score = 27.9 bits (59), Expect = 3.9 Identities = 18/63 (28%), Positives = 35/63 (55%) Frame = -2 Query: 254 LKMTSESHILIFPSSIFSTISLAAFSLDSLTQPSVSPDLKSMYATSAPNLVRASFKSSLF 75 L SE +IF SS+ +S+ S+ SLT+ +++ K++ A + +RA+ + F Sbjct: 132 LLKASEFGSIIFISSVGGVVSMECGSIYSLTKGALNQLAKTLACEWARDGIRANSVAPNF 191 Query: 74 IFS 66 I++ Sbjct: 192 IYT 194 >At1g76090.1 68414.m08836 S-adenosyl-methionine-sterol-C-methyltransferase identical to S-adenosyl-methionine-sterol-C-methyltransferase GI:2246456 from [Arabidopsis thaliana] Length = 359 Score = 27.5 bits (58), Expect = 5.2 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = +2 Query: 116 LRSHTLISNLVTPKVGSDCLK-----KTPLKKWLKRLKMERLRY 232 LRS+ I+ + KVG + +K K P K W RLKM R+ Y Sbjct: 258 LRSYADIA-VTAKKVGFEVVKEKDLAKPPSKPWWNRLKMGRIAY 300 >At4g35210.1 68417.m05004 hypothetical protein contains Pfam profile PF03087: Arabidopsis protein of unknown function Length = 250 Score = 27.1 bits (57), Expect = 6.9 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 6/118 (5%) Frame = +1 Query: 154 EGWVRLSKENAA--KEMVEKIEDGKIKICD----SEVIFNCLKVTMRKRISLKPWKR*PK 315 E +RLS N A ++ +EK+ DG IKI D S+ + +K ++++ S+ KR Sbjct: 56 EKMIRLSVTNQALSQDQIEKLLDGSIKILDLCSISKDGLSQMKESLKEIQSIVRRKR--- 112 Query: 316 NAGT*GITSSVKERISKGDKAVERESPKIMKRHLQRKSKRSNQNSQTALRMFCASEAI 489 G S+ ++ K +++ K++ KS +++QN AL +F +E + Sbjct: 113 -----GDLSAEVKKYLASRKFLKKSFEKVL------KSLKTSQNKNDALAVFGEAETV 159 >At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1) (FAS1) identical to FAS1 [Arabidopsis thaliana] GI:4887626 Length = 815 Score = 27.1 bits (57), Expect = 6.9 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +1 Query: 58 EVNEKMKREDLKDALTKLGAEVAYIDFKSGDTEGWVRLSKENAAKE 195 E EK+ R DL A KLG ++ +D +S + S E A K+ Sbjct: 195 EETEKLWRSDLSKAAEKLGKILSEVDIRSFMDNMMQKNSSEMAEKD 240 >At1g67460.1 68414.m07681 hypothetical protein contains Pfam domain PF03193: Protein of unknown function, DUF258 Length = 434 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +1 Query: 367 GDKAVERESPKIMKRHLQRKSKRSNQNSQTALR 465 G+K VE+ P+I + +R+S+++ ++ + LR Sbjct: 395 GEKGVEQAKPRIDPKKYRRESRKTMKDERAILR 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,597,706 Number of Sequences: 28952 Number of extensions: 156697 Number of successful extensions: 653 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -