BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0579.Seq (487 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 1.1 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 23 1.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 1.1 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 2.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.9 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 23.4 bits (48), Expect = 1.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 367 ALEDAIEGEKTEQWRAQGQELLIQAKK 287 AL + + E T WR Q +L+Q ++ Sbjct: 541 ALGEVLWSEPTNTWREAEQRILVQRER 567 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 23.4 bits (48), Expect = 1.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 246 AHVRLH*GEAASGLPAREVERGASSRPEAHGRLDSEQR 133 AHVR H GE P + SS H R S +R Sbjct: 39 AHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGER 76 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.4 bits (48), Expect = 1.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 246 AHVRLH*GEAASGLPAREVERGASSRPEAHGRLDSEQR 133 AHVR H GE P + SS H R S +R Sbjct: 295 AHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGER 332 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 218 RRLDYQLEKSNVERRLAQKHMVD 150 RRL+ LEKS + +H VD Sbjct: 148 RRLEMSLEKSGLFSSKTSEHSVD 170 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 55 SERKRTLFMYRSVIKII 5 S +K+T + YRSV +I Sbjct: 234 SSKKKTRYYYRSVDDVI 250 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,452 Number of Sequences: 336 Number of extensions: 1816 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -