BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0577.Seq (487 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes ... 63 3e-09 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 45 8e-04 UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein;... 42 0.010 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 39 0.052 UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|... 36 0.49 UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B... 36 0.64 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 35 1.1 UniRef50_UPI0000DA1C3D Cluster: PREDICTED: similar to CCR4-NOT t... 33 2.6 UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; ... 33 3.4 UniRef50_Q8WXI7 Cluster: Mucin-16; n=23; cellular organisms|Rep:... 33 3.4 UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1; ... 33 4.5 UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal hy... 33 4.5 UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar p... 32 6.0 UniRef50_Q9ZVV9 Cluster: Putative uncharacterized protein At2g07... 32 6.0 UniRef50_A4RKZ9 Cluster: Putative uncharacterized protein; n=3; ... 32 6.0 UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, R... 32 7.9 >UniRef50_Q4PMZ6 Cluster: Putative secreted protein; n=1; Ixodes scapularis|Rep: Putative secreted protein - Ixodes scapularis (Black-legged tick) (Deer tick) Length = 65 Score = 63.3 bits (147), Expect = 3e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = +3 Query: 54 PY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSDGMSAFIRSKPI 212 P G+TANGS+ Q WFLRS+ TWITV ILELIHA+ AFIR + I Sbjct: 2 PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSI 54 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 45.2 bits (102), Expect = 8e-04 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 433 LLPSLXVVAVSQAPSPESNPDSP 365 LLPSL VVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_UPI0000E7FA5A Cluster: PREDICTED: hypothetical protein; n=2; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 508 Score = 41.5 bits (93), Expect = 0.010 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = +2 Query: 119 YLDNCGNSRANTCNQNSDQ*WDECFY*IKTN 211 YLDNCGNSRANTC + D C Y KTN Sbjct: 468 YLDNCGNSRANTCRRAPTS-GDACIYQTKTN 497 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 39.1 bits (87), Expect = 0.052 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -1 Query: 412 VAVSQAPSPESNPDSPLPVTTMVVAETTIES 320 +A+SQAPSPESN +SPLPV M+ I+S Sbjct: 372 LAISQAPSPESNSNSPLPVKAMLGQYPNIKS 402 >UniRef50_Q28GS0 Cluster: Novel protein; n=1; Xenopus tropicalis|Rep: Novel protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 118 Score = 35.9 bits (79), Expect = 0.49 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 305 MSALSTFDGSFCDYHG 352 MSALSTFDG+FC YHG Sbjct: 1 MSALSTFDGTFCAYHG 16 >UniRef50_Q6Z8F1 Cluster: Putative uncharacterized protein P0459B01.16; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0459B01.16 - Oryza sativa subsp. japonica (Rice) Length = 172 Score = 35.5 bits (78), Expect = 0.64 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 1 PVVICLSQRLSHACLS 48 PVVICLSQRLSHAC S Sbjct: 155 PVVICLSQRLSHACAS 170 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 34.7 bits (76), Expect = 1.1 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -1 Query: 466 PPRAGSG*FARLLPSLXVVAVSQAPSP 386 PP+ SG +RLL + +VA+SQAPSP Sbjct: 46 PPKVSSGKVSRLLLPVDIVAISQAPSP 72 >UniRef50_UPI0000DA1C3D Cluster: PREDICTED: similar to CCR4-NOT transcription complex, subunit 3; n=1; Rattus norvegicus|Rep: PREDICTED: similar to CCR4-NOT transcription complex, subunit 3 - Rattus norvegicus Length = 750 Score = 33.5 bits (73), Expect = 2.6 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = -1 Query: 475 SSLPPRAGSG*FARLLPSLXVVAVSQAPSPESNPDSPLP 359 +++P G G A P L + A S PSPE PD+PLP Sbjct: 607 AAIPTGHGRGRLAPHAPPLXLRAHSAVPSPEPLPDTPLP 645 >UniRef50_Q0FI72 Cluster: Putative uncharacterized protein; n=1; Roseovarius sp. HTCC2601|Rep: Putative uncharacterized protein - Roseovarius sp. HTCC2601 Length = 507 Score = 33.1 bits (72), Expect = 3.4 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +3 Query: 111 YSVTWITVVILELIHAIRTLTSDGMSAFIRSKPIDGGPRV 230 YS T + VV+ EL+ T+ SD +A I + P+DG R+ Sbjct: 139 YSATSMAVVLSELVVDDETIPSDNAAAQISAGPVDGETRI 178 >UniRef50_Q8WXI7 Cluster: Mucin-16; n=23; cellular organisms|Rep: Mucin-16 - Homo sapiens (Human) Length = 22152 Score = 33.1 bits (72), Expect = 3.4 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -1 Query: 481 YFSSLPPRAGSG*FARLLPSLXVVAVSQAPSPESNPDSPLPVTTMVVA 338 + ++ P S F+ + PS+ + + SPES P SPLPVT ++ + Sbjct: 5621 WMTTPPVEETSSGFSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668 >UniRef50_A2D9Z7 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 872 Score = 32.7 bits (71), Expect = 4.5 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 430 LPSLXVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLKD 296 +PSL V++SQ P+ P +PLP +++E E G + D Sbjct: 67 IPSLPPVSISQTIKPQIIPQNPLPTMNHIISEPLDEPASGEEMAD 111 >UniRef50_O60079 Cluster: Probable ubiquitin carboxyl-terminal hydrolase 12; n=1; Schizosaccharomyces pombe|Rep: Probable ubiquitin carboxyl-terminal hydrolase 12 - Schizosaccharomyces pombe (Fission yeast) Length = 979 Score = 32.7 bits (71), Expect = 4.5 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +1 Query: 226 ASEVVNFDESDNFCRSHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 396 + E+++F E G + L C+IN W LRL +L + NQ S E++ Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302 Query: 397 PEKRLP 414 EKR+P Sbjct: 303 QEKRVP 308 >UniRef50_UPI0000E4A253 Cluster: PREDICTED: similar to Vacuolar protein sorting protein 36 (ELL-associated protein of 45 kDa), partial; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Vacuolar protein sorting protein 36 (ELL-associated protein of 45 kDa), partial - Strongylocentrotus purpuratus Length = 349 Score = 32.3 bits (70), Expect = 6.0 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 368 PVTRDNHGSRRNYHRKLIRQTFERCVA 288 PVTR+ HGS YH +L +Q E +A Sbjct: 190 PVTRETHGSGLKYHEELAKQLSEALIA 216 >UniRef50_Q9ZVV9 Cluster: Putative uncharacterized protein At2g07020; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein At2g07020 - Arabidopsis thaliana (Mouse-ear cress) Length = 620 Score = 32.3 bits (70), Expect = 6.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 260 LSDSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 159 +SDS S RPS+DWF N+S + + SS+ Sbjct: 230 VSDSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 263 >UniRef50_A4RKZ9 Cluster: Putative uncharacterized protein; n=3; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 775 Score = 32.3 bits (70), Expect = 6.0 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +1 Query: 172 PVMG*VLLLDQNQSTEGLASEVVNFDESDNFCRSHGQVP 288 P+M +L L Q+ T G AS V+ FD ++CR H +P Sbjct: 85 PIMLGMLWLKQHDPTIGFASHVITFD--SDYCRRHCNMP 121 >UniRef50_Q8BL71 Cluster: Adult male corpora quadrigemina cDNA, RIKEN full-length enriched library, clone:B230353G19 product:weakly similar to GROUP III SECRETED PHOSPHOLIPASE A2; n=1; Mus musculus|Rep: Adult male corpora quadrigemina cDNA, RIKEN full-length enriched library, clone:B230353G19 product:weakly similar to GROUP III SECRETED PHOSPHOLIPASE A2 - Mus musculus (Mouse) Length = 218 Score = 31.9 bits (69), Expect = 7.9 Identities = 19/78 (24%), Positives = 28/78 (35%) Frame = +1 Query: 196 LDQNQSTEGLASEVVNFDESDNFCRSHGQVPATHLSNVCLINFRW*FLRLPWLSRVTGNQ 375 L N ++ + D CR++G P HL N W + S Q Sbjct: 58 LQYNYGIRNFRFHTISHCDCDARCRAYGSTPLAHLRPRTYYNASW---KAEATSYTPSPQ 114 Query: 376 GSIPEREPEKRLPHXRKA 429 P + P+KR P +A Sbjct: 115 SPAPSKHPQKRGPQQTQA 132 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,073,716 Number of Sequences: 1657284 Number of extensions: 9187351 Number of successful extensions: 22194 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 21435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22182 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 28130105105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -