BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0577.Seq (487 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium bind... 28 4.1 AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 4.1 Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical pr... 27 5.5 Z79752-4|CAB02083.1| 1188|Caenorhabditis elegans Hypothetical pr... 27 9.5 AF016669-1|AAB66098.3| 1758|Caenorhabditis elegans Signal elemen... 27 9.5 >AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium binding protein homologprotein 1, isoform d protein. Length = 679 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 430 LPSLXVVAVSQAPSPESNPDSPLPVTTMVVAETTI 326 +P+ V+ ++ PS +S + VTT V+ TTI Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 66 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 170 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 >Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical protein C34C6.3 protein. Length = 520 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 108 SYSVTWITVVILELIHAIRTLTSDGMS 188 SY+V+WIT + IR + SDG++ Sbjct: 54 SYNVSWITPAASNSTYRIRLIDSDGLT 80 >Z79752-4|CAB02083.1| 1188|Caenorhabditis elegans Hypothetical protein D2005.4 protein. Length = 1188 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 93 TDILSHSRYRLNTACTETC 37 T++L H+R+ L AC E C Sbjct: 245 TEVLKHARFCLGLACCERC 263 >AF016669-1|AAB66098.3| 1758|Caenorhabditis elegans Signal element on autosome protein2 protein. Length = 1758 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 427 PSLXVVAVSQAPSP-ESNPDSPLPVT-TMVVAETTI 326 P+ ++ SQAP P ++ P SP+ T T+ +TT+ Sbjct: 774 PATPMLQASQAPQPLQAPPQSPMETTATVTYTKTTV 809 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,049,845 Number of Sequences: 27780 Number of extensions: 213424 Number of successful extensions: 528 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -